AMPDB_4288 | Apidaecins type 14

PEPTIDE SUMMARY

Apidaecins type 14

1 General Description

AMPDB ID: AMPDB_4288

Protein Names: Apidaecins type 14 [Cleaved into: Apidaecin-2 (Apidaecin II); Apidaecin-1B (Apidaecin IB); Apidaecin-1A (Apidaecin IA)]

Protein Family: Apidaecin family

Gene Name: APID14

Source Organism: Apis mellifera (Honeybee)

Protein Length: 168 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKNFALAILVVTFVVAVFGNTNLDPPTRPARLRREAKPEAEPGNNRPIYIPQPRPPHPRLRREAEPKAEPGNNRPIYIPQPRPPHPRLRREAESEAEPGNNRPVYIPQPRPPHPRLRREPEAEPGNNRPVYIPQPRPPHPRLRREPEAEPGNNRPVYIPQPRPPHPRI

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 12, 'R': 27, 'N': 13, 'D': 1, 'C': 0, 'Q': 5, 'E': 16, 'G': 6, 'H': 5, 'I': 9, 'L': 8, 'K': 3, 'M': 1, 'F': 3, 'P': 42, 'S': 1, 'T': 3, 'W': 0, 'Y': 5, 'V': 8

Frequencies of Amino Acids

'A': 7.14%, 'R': 16.07%, 'N': 7.74%, 'D': 0.6%, 'C': 0%, 'Q': 2.98%, 'E': 9.52%, 'G': 3.57%, 'H': 2.98%, 'I': 5.36%, 'L': 4.76%, 'K': 1.79%, 'M': 0.6%, 'F': 1.79%, 'P': 25%, 'S': 0.6%, 'T': 1.79%, 'W': 0%, 'Y': 2.98%, 'V': 4.76%

Missing Amino Acid(s)

C, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, M, S

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	19380.2 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	60.417	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	70.879	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-1.276	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.537	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.787	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	13.476	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.196, 0.369, 0.22 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.048	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	7450, 7450	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Casteels-Josson K, Capaci T, Casteels P, et al. Apidaecin multipeptide precursor structure: a putative mechanism for amplification of the insect antibacterial response. EMBO J. 1993;12(4):1569-78. Published 1993 Apr. doi:10.1002/j.1460-2075.1993.tb05801.x

PMID: 8467807

Citation 2: Casteels P, Ampe C, Jacobs F, et al. Apidaecins: antibacterial peptides from honeybees. EMBO J. 1989;8(8):2387-91. Published 1989 Aug. doi:10.1002/j.1460-2075.1989.tb08368.x

PMID: 2676519

Citation 3: Casteels P, Romagnolo J, Castle M, et al. Biodiversity of apidaecin-type peptide antibiotics. Prospects of manipulating the antibacterial spectrum and combating acquired resistance. J Biol Chem. 1994;269(42):26107-15. Published 1994 Oct 21. doi:

PMID: 7929322

5.2 Protein Sequence Databases

UniProt: Q06601

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q06601

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X72575	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_001011613.1

5.5 Protein-Protein Interaction Databases

STRING: 7460.GB51306-PA

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR004828

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: ame:406140

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download