AMPDB_4287 | Cecropin-2

PEPTIDE SUMMARY

Cecropin-2

1 General Description

AMPDB ID: AMPDB_4287

Protein Names: Cecropin-2

Protein Family: Cecropin family

Gene Name: CEC2

Source Organism: Ceratitis capitata (Mediterranean fruit fly) (Tephritis capitata)

Protein Length: 63 AA

Protein Existence: Inferred from homology

2 Protein Sequence & Composition

2.1 Sequence

MNFNKVLVLLAVIFAVFAGQTEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 10, 'R': 2, 'N': 3, 'D': 1, 'C': 0, 'Q': 5, 'E': 2, 'G': 6, 'H': 1, 'I': 5, 'L': 5, 'K': 6, 'M': 1, 'F': 3, 'P': 0, 'S': 0, 'T': 5, 'W': 1, 'Y': 0, 'V': 7

Frequencies of Amino Acids

'A': 15.87%, 'R': 3.17%, 'N': 4.76%, 'D': 1.59%, 'C': 0%, 'Q': 7.94%, 'E': 3.17%, 'G': 9.52%, 'H': 1.59%, 'I': 7.94%, 'L': 7.94%, 'K': 9.52%, 'M': 1.59%, 'F': 4.76%, 'P': 0%, 'S': 0%, 'T': 7.94%, 'W': 1.59%, 'Y': 0%, 'V': 11.11%

Missing Amino Acid(s)

C, P, S, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, H, M, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6735.94 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	110	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	16.243	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.29	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.936	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.079	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	5.091	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.333, 0.143, 0.286 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.063	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5500	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Rosetto M, Manetti AG, Marchini D, et al. Sequences of two cDNA clones from the medfly Ceratitis capitata encoding antibacterial peptides of the cecropin family. Gene. 1993;134(2):241-3. Published 1993 Dec 8. doi:10.1016/0378-1119(93)90100-h

PMID: 7916722

5.2 Protein Sequence Databases

UniProt: Q06590

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q06590

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X70029	GenBank \|\| EMBL

CCDS: Not found

RefSeq: XP_004534330.1, XP_012160526.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR000875, IPR020400

PANTHER: PTHR38329

PROSITE: PS00268

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: ccat:101456416

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download