AMPDB_4282 | Defensin D2

PEPTIDE SUMMARY

Defensin D2

1 General Description

AMPDB ID: AMPDB_4282

Protein Names: Defensin D2 (Ns-D2)

Protein Family: DEFL family

Gene Name: Nil

Source Organism: Nigella sativa (Black cumin)

Protein Length: 50 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

KFCEKPSGTWSGVCGNSGACKDQCIRLEGAKHGSCNYKLPAHRCICYYEC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 2, 'N': 2, 'D': 1, 'C': 8, 'Q': 1, 'E': 3, 'G': 6, 'H': 2, 'I': 2, 'L': 2, 'K': 5, 'M': 0, 'F': 1, 'P': 2, 'S': 4, 'T': 1, 'W': 1, 'Y': 3, 'V': 1

Frequencies of Amino Acids

'A': 6%, 'R': 4%, 'N': 4%, 'D': 2%, 'C': 16%, 'Q': 2%, 'E': 6%, 'G': 12%, 'H': 4%, 'I': 4%, 'L': 4%, 'K': 10%, 'M': 0%, 'F': 2%, 'P': 4%, 'S': 8%, 'T': 2%, 'W': 2%, 'Y': 6%, 'V': 2%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, F, Q, T, V, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	5503.31 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	43	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	28.128	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.494	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.365	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.207	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	2.686	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.2, 0.28, 0.16 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.1	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	9970, 10470	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

A.niger, B.cinerea, B.sorokiniana, F.culmorum, F.graminearum, F.oxysporum

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Plant defense

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Rogozhin EA, Oshchepkova YI, Odintsova TI, et al. Novel antifungal defensins from Nigella sativa L. seeds. Plant Physiol Biochem. 2011;49(2):131-7. Published 2011 Feb. doi:10.1016/j.plaphy.2010.10.008

PMID: 21144761

5.2 Protein Sequence Databases

UniProt: P86973

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P86973

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR008176, IPR003614, IPR036574

PANTHER: Not found

PROSITE: PS00940

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download