AMPDB_4281 | Defensin D1
PEPTIDE SUMMARY
Defensin D1
1 General Description
AMPDB ID: AMPDB_4281
Protein Names: Defensin D1 (Ns-D1)
Protein Family: DEFL family
Gene Name: Nil
Protein Length: 50 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
KFCEKPSGTWSGVCGNSGACKDQCIRLEGAKHGSCNYKPPAHRCICYYEC
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 3, 'R': 2, 'N': 2, 'D': 1, 'C': 8, 'Q': 1, 'E': 3, 'G': 6, 'H': 2, 'I': 2, 'L': 1, 'K': 5, 'M': 0, 'F': 1, 'P': 3, 'S': 4, 'T': 1, 'W': 1, 'Y': 3, 'V': 1
Frequencies of Amino Acids
'A': 6%, 'R': 4%, 'N': 4%, 'D': 2%, 'C': 16%, 'Q': 2%, 'E': 6%, 'G': 12%, 'H': 4%, 'I': 4%, 'L': 2%, 'K': 10%, 'M': 0%, 'F': 2%, 'P': 6%, 'S': 8%, 'T': 2%, 'W': 2%, 'Y': 6%, 'V': 2%
Missing Amino Acid(s)
M
Most Occurring Amino Acid(s)
C
Less Occurring Amino Acid(s)
D, F, L, Q, T, V, W
Hydrophobic Amino Acid(s) Count
18
Hydrophilic Amino Acid(s) Count
32
Basic Amino Acid(s) Count
4
Acidic Amino Acid(s) Count
9
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 5487.27 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 35.2 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 28.318 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.602 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.368 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 8.207 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 2.686 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.18, 0.3, 0.14 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.1 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 9970, 10470 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
A.niger, B.cinerea, B.sorokiniana, F.culmorum, F.graminearum, F.oxysporum
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Fungicide, Plant defense
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Rogozhin EA, Oshchepkova YI, Odintsova TI, et al. Novel antifungal defensins from Nigella sativa L. seeds. Plant Physiol Biochem. 2011;49(2):131-7. Published 2011 Feb. doi:10.1016/j.plaphy.2010.10.008
PMID: 21144761
5.2 Protein Sequence Databases
UniProt: P86972
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: P86972
5.4 Nucleotide Sequence Databases
No entries found in GenBank or EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
PANTHER: Not found
PROSITE: PS00940
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India