AMPDB_4280 | Trypsin inhibitor

PEPTIDE SUMMARY

Trypsin inhibitor

1 General Description

AMPDB ID: AMPDB_4280

Protein Names: Trypsin inhibitor (FtTI)

Protein Family: Protease inhibitor I13 (potato type I serine protease inhibitor) family

Gene Name: Nil

Source Organism: Fagopyrum tataricum (Tartarian buckwheat) (Polygonum tataricum)

Protein Length: 86 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

LIYAKVECLTTGVRTYVGKQSWPELVGTKGKTAAATIDKENTHVTAVLCPPLTTLAACRTFDFRCDRVRVLINRIGGVVTKTPTVG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 7, 'R': 6, 'N': 2, 'D': 3, 'C': 4, 'Q': 1, 'E': 3, 'G': 7, 'H': 1, 'I': 4, 'L': 7, 'K': 6, 'M': 0, 'F': 2, 'P': 4, 'S': 1, 'T': 14, 'W': 1, 'Y': 2, 'V': 11

Frequencies of Amino Acids

'A': 8.14%, 'R': 6.98%, 'N': 2.33%, 'D': 3.49%, 'C': 4.65%, 'Q': 1.16%, 'E': 3.49%, 'G': 8.14%, 'H': 1.16%, 'I': 4.65%, 'L': 8.14%, 'K': 6.98%, 'M': 0%, 'F': 2.33%, 'P': 4.65%, 'S': 1.16%, 'T': 16.28%, 'W': 1.16%, 'Y': 2.33%, 'V': 12.79%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, Q, S, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9292.89 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	95.116	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	31.415	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.123	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.635	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.809	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	5.844	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.314, 0.163, 0.198 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.058	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	8480, 8730	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

A.cucumerina, A.solani

4.2 Antimicrobial Activity

Antimicrobial, Fungicide, Plant defense

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Protease inhibitor, Serine protease inhibitor

4.5 Other Biological Activity

Enzyme inhibitor, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Ruan JJ, Zhou ML, Chen H, et al. Identification and Characterization of a Trypsin Inhibitor from Fagopyrum tataricum Seeds. Appl Biochem Biotechnol. 2011;. Published 2011 May 5. doi:10.1007/s12010-011-9257-4

PMID: 21544554

5.2 Protein Sequence Databases

UniProt: P86971

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P86971

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR000864, IPR036354

PANTHER: PTHR33091

PROSITE: PS00285

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download