AMPDB_428 | Crassicorin-I

PEPTIDE SUMMARY

Crassicorin-I

1 General Description

AMPDB ID: AMPDB_428

Protein Names: Crassicorin-I (BDS-like antimicrobial peptide) (BDS-like AMP)

Protein Family: Sea anemone type 3 (BDS) potassium channel toxin family

Gene Name: Nil

Source Organism: Urticina crassicornis (Mottled anemone) (Tealia crassicornis)

Protein Length: 79 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKLFLVSIVLVGMLVLAAARPERDIDSFDEQEEKGFVKRGASCDCHPFVGTYWFGISNCPSGHGYRKKCASFFGVCCVK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 4, 'N': 1, 'D': 4, 'C': 6, 'Q': 1, 'E': 4, 'G': 8, 'H': 2, 'I': 3, 'L': 5, 'K': 6, 'M': 2, 'F': 7, 'P': 3, 'S': 6, 'T': 1, 'W': 1, 'Y': 2, 'V': 8

Frequencies of Amino Acids

'A': 6.33%, 'R': 5.06%, 'N': 1.27%, 'D': 5.06%, 'C': 7.59%, 'Q': 1.27%, 'E': 5.06%, 'G': 10.13%, 'H': 2.53%, 'I': 3.8%, 'L': 6.33%, 'K': 7.59%, 'M': 2.53%, 'F': 8.86%, 'P': 3.8%, 'S': 7.59%, 'T': 1.27%, 'W': 1.27%, 'Y': 2.53%, 'V': 10.13%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

G, V

Less Occurring Amino Acid(s)

N, Q, T, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8754.23 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	75.19	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	31.72	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.173	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.615	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.12	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.813	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.329, 0.228, 0.203 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.127	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	8480, 8855	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.subtilis (Gram-positive), E.coli (Gram-negative), P.paucidens, S.enterica (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Toxin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Kim CH, Lee YJ, Go HJ, et al. Defensin-neurotoxin dyad in a basally branching metazoan sea anemone. FEBS J. 2017;284(19):3320-3338. Published 2017 Oct. doi:10.1111/febs.14194

PMID: 28796463

5.2 Protein Sequence Databases

UniProt: A0A1X9QHL1

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A0A1X9QHL1

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	KY229683	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR012414, IPR023355

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download