AMPDB_4274 | Alpha-defensin PhD-4
PEPTIDE SUMMARY
Alpha-defensin PhD-4
1 General Description
AMPDB ID: AMPDB_4274
Protein Names: Alpha-defensin PhD-4
Protein Family: Alpha-defensin family
Gene Name: Nil
Protein Length: 30 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
ACYCRIPACFAGERRYGTCFYLGRVWAFCC
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 4, 'R': 4, 'N': 0, 'D': 0, 'C': 6, 'Q': 0, 'E': 1, 'G': 3, 'H': 0, 'I': 1, 'L': 1, 'K': 0, 'M': 0, 'F': 3, 'P': 1, 'S': 0, 'T': 1, 'W': 1, 'Y': 3, 'V': 1
Frequencies of Amino Acids
'A': 13.33%, 'R': 13.33%, 'N': 0%, 'D': 0%, 'C': 20%, 'Q': 0%, 'E': 3.33%, 'G': 10%, 'H': 0%, 'I': 3.33%, 'L': 3.33%, 'K': 0%, 'M': 0%, 'F': 10%, 'P': 3.33%, 'S': 0%, 'T': 3.33%, 'W': 3.33%, 'Y': 10%, 'V': 3.33%
Missing Amino Acid(s)
D, H, K, M, N, Q, S
Most Occurring Amino Acid(s)
C
Less Occurring Amino Acid(s)
E, I, L, P, T, V, W
Hydrophobic Amino Acid(s) Count
15
Hydrophilic Amino Acid(s) Count
15
Basic Amino Acid(s) Count
1
Acidic Amino Acid(s) Count
4
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 3487.13 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 49 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 58.683 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.443 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.346 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 8.375 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 2.625 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.333, 0.133, 0.2 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.233 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 9970, 10345 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
C.albicans, E.coli (Gram-negative), L.monocytogenes (Gram-positive), S.aureus (Gram-positive)
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Defensin, Fungicide, Anti-MRSA, Anti-candida, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Stegemann C, Tsvetkova EV, Aleshina GM, et al. De novo sequencing of two new cyclic theta-defensins from baboon (Papio hamadryas) leukocytes by matrix-assisted laser desorption/ionization mass spectrometry. Rapid Commun Mass Spectrom. 2010;24(5):599-604. Published 2010 Mar 15. doi:10.1002/rcm.4424
PMID: 20155756
5.2 Protein Sequence Databases
UniProt: P86724
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: P86724
5.4 Nucleotide Sequence Databases
No entries found in GenBank or EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
PANTHER: PTHR11876
PROSITE: PS00269
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India