AMPDB_42701 | HNH endonuclease

PEPTIDE SUMMARY

HNH endonuclease

1 General Description

AMPDB ID: AMPDB_42701

Protein Names: HNH endonuclease

Protein Family: Colicin pyosin nuclease family

Gene Name: C3433_22100

Source Organism: Citrobacter freundii

Protein Length: 211 AA

Protein Existence: Inferred from homology

2 Protein Sequence & Composition

2.1 Sequence

MITWTPERPEGSDVRAHTGSDIKPIDQATILVTPIPDGKDEYTTPPFLVPEERDLNDYILVFPADSGIKPIYVYLKTARDEPGVATGKGEILSGSEKWLEAASSGQGAPVPAQVADKLRGKSFRNFDHFREEFWLAVAECPELLSQFNKSNQMIIKNGGAPFVIEEQAVGGRELFELHHVKQIQYDGPVYDMDNLRVNTPRNHIRIHKEEK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 14, 'R': 11, 'N': 8, 'D': 14, 'C': 1, 'Q': 8, 'E': 19, 'G': 16, 'H': 6, 'I': 15, 'L': 14, 'K': 13, 'M': 3, 'F': 9, 'P': 17, 'S': 10, 'T': 10, 'W': 3, 'Y': 6, 'V': 14

Frequencies of Amino Acids

'A': 6.64%, 'R': 5.21%, 'N': 3.79%, 'D': 6.64%, 'C': 0.47%, 'Q': 3.79%, 'E': 9%, 'G': 7.58%, 'H': 2.84%, 'I': 7.11%, 'L': 6.64%, 'K': 6.16%, 'M': 1.42%, 'F': 4.27%, 'P': 8.06%, 'S': 4.74%, 'T': 4.74%, 'W': 1.42%, 'Y': 2.84%, 'V': 6.64%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

105

Hydrophilic Amino Acid(s) Count

106

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	23696.7 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	79.479	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	42.541	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.53	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.583	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	5.001	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-8.488	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.289, 0.242, 0.237 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.085	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	25440, 25440	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-gram-negative

4.3 Enzymatic Activity

Endonuclease, Hydrolase, Nuclease

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

No PMID found

5.2 Protein Sequence Databases

UniProt: A0A2S4Q8Q3

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A0A2S4Q8Q3

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	PQLY01000011	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR037146, IPR044925, IPR003615, IPR003060, IPR016128, IPR036302

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download