AMPDB_4246 | Non-specific lipid-transfer protein 1
PEPTIDE SUMMARY
Non-specific lipid-transfer protein 1
1 General Description
AMPDB ID: AMPDB_4246
Protein Names: Non-specific lipid-transfer protein 1 (LTP 1)
Protein Family: Plant LTP family
Gene Name: Nil
Protein Length: 35 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
ISCQDVKQSLAPCLPYVTGRAPKPAPGCCNGINHL
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 3, 'R': 1, 'N': 2, 'D': 1, 'C': 4, 'Q': 2, 'E': 0, 'G': 3, 'H': 1, 'I': 2, 'L': 3, 'K': 2, 'M': 0, 'F': 0, 'P': 5, 'S': 2, 'T': 1, 'W': 0, 'Y': 1, 'V': 2
Frequencies of Amino Acids
'A': 8.57%, 'R': 2.86%, 'N': 5.71%, 'D': 2.86%, 'C': 11.43%, 'Q': 5.71%, 'E': 0%, 'G': 8.57%, 'H': 2.86%, 'I': 5.71%, 'L': 8.57%, 'K': 5.71%, 'M': 0%, 'F': 0%, 'P': 14.29%, 'S': 5.71%, 'T': 2.86%, 'W': 0%, 'Y': 2.86%, 'V': 5.71%
Missing Amino Acid(s)
E, F, M, W
Most Occurring Amino Acid(s)
P
Less Occurring Amino Acid(s)
D, H, R, T, Y
Hydrophobic Amino Acid(s) Count
18
Hydrophilic Amino Acid(s) Count
17
Basic Amino Acid(s) Count
1
Acidic Amino Acid(s) Count
4
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 3652.28 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 80.857 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 58.011 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.046 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.452 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 8.34 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 1.84 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.229, 0.343, 0.171 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.029 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 1490, 1740 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
F.oxysporum, P.infestans
4.2 Antimicrobial Activity
Antimicrobial, Fungicide, Plant defense
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Oshchepkova IuI, Veshkurova ON, Rogozhin EA, et al. [Isolation of the lipid-transporting protein Ns-LTP1 from seeds of the garden fennel flower (Nigella sativa)]. Bioorg Khim. 2009;35(3):344-9. Published 2009 May-Jun. doi:10.1134/s1068162009030054
PMID: 19621049
5.2 Protein Sequence Databases
UniProt: P86527
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: P86527
5.4 Nucleotide Sequence Databases
No entries found in GenBank or EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India