AMPDB_422 | Cruzioseptin-2
PEPTIDE SUMMARY
Cruzioseptin-2
1 General Description
AMPDB ID: AMPDB_422
Protein Names: Cruzioseptin-2 (CZS-2)
Protein Family: Frog skin active peptide (FSAP) family; Cruzioseptin subfamily
Gene Name: Nil
Protein Length: 71 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MAFLKKSLFLVLFLGLVSLSICEEEKREEENEEVQEDDDQSEEKRGFLDVIKHVGKAALGVVTHLINQGEQ
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 3, 'R': 2, 'N': 2, 'D': 4, 'C': 1, 'Q': 4, 'E': 12, 'G': 5, 'H': 2, 'I': 3, 'L': 10, 'K': 6, 'M': 1, 'F': 4, 'P': 0, 'S': 4, 'T': 1, 'W': 0, 'Y': 0, 'V': 7
Frequencies of Amino Acids
'A': 4.23%, 'R': 2.82%, 'N': 2.82%, 'D': 5.63%, 'C': 1.41%, 'Q': 5.63%, 'E': 16.9%, 'G': 7.04%, 'H': 2.82%, 'I': 4.23%, 'L': 14.08%, 'K': 8.45%, 'M': 1.41%, 'F': 5.63%, 'P': 0%, 'S': 5.63%, 'T': 1.41%, 'W': 0%, 'Y': 0%, 'V': 9.86%
Missing Amino Acid(s)
P, W, Y
Most Occurring Amino Acid(s)
E
Less Occurring Amino Acid(s)
C, M, T
Hydrophobic Amino Acid(s) Count
33
Hydrophilic Amino Acid(s) Count
38
Basic Amino Acid(s) Count
16
Acidic Amino Acid(s) Count
10
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 8060.14 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 104.225 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 56.07 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.279 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.746 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 4.293 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) -7.861 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.338, 0.155, 0.366 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.056 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 0, 0 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
C.albicans, E.coli (Gram-negative), S.aureus (Gram-positive)
4.2 Antimicrobial Activity
Amphibian defense peptide, Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Proaño-Bolaños C, Zhou M, Wang L, et al. Peptidomic approach identifies cruzioseptins, a new family of potent antimicrobial peptides in the splendid leaf frog, Cruziohyla calcarifer. J Proteomics. 2016;146:1-13. Published 2016 Sep 2. doi:10.1016/j.jprot.2016.06.017
PMID: 27321580
5.2 Protein Sequence Databases
UniProt: A0A193H362
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: A0A193H362
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. KX065079 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR004275, IPR016322
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India