AMPDB_420 | Non-specific lipid-transfer protein 1

PEPTIDE SUMMARY

Non-specific lipid-transfer protein 1

1 General Description

AMPDB ID: AMPDB_420

Protein Names: Non-specific lipid-transfer protein 1 (PsLTP1) (allergen Pis s 3)

Protein Family: Plant LTP family

Gene Name: Nil

Source Organism: Pisum sativum (Garden pea)

Protein Length: 120 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MARSMKLACVALVICMVVIAPMAEAALSCGTVSADMAPCVTYLQAPNNASPPPPCCAGVKKLLAAATTTPDRQAACNCLKSAAGSIPKLNTNNAAALPGKCGVSIPYKISTSTNCNTVRF

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 22, 'R': 3, 'N': 8, 'D': 2, 'C': 10, 'Q': 2, 'E': 1, 'G': 5, 'H': 0, 'I': 5, 'L': 9, 'K': 7, 'M': 5, 'F': 1, 'P': 11, 'S': 9, 'T': 9, 'W': 0, 'Y': 2, 'V': 9

Frequencies of Amino Acids

'A': 18.33%, 'R': 2.5%, 'N': 6.67%, 'D': 1.67%, 'C': 8.33%, 'Q': 1.67%, 'E': 0.83%, 'G': 4.17%, 'H': 0%, 'I': 4.17%, 'L': 7.5%, 'K': 5.83%, 'M': 4.17%, 'F': 0.83%, 'P': 9.17%, 'S': 7.5%, 'T': 7.5%, 'W': 0%, 'Y': 1.67%, 'V': 7.5%

Missing Amino Acid(s)

H, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

E, F

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	12160.4 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	85.583	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	34.358	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.412	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.508	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.728	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	6.377	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.217, 0.275, 0.308 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.025	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 3605	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

A.niger, A.tumefaciens (Gram-negative), C.michiganensis (Gram-positive), F.oxysporum, F.solani (Gram-positive), N.crassa, P.syringae (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Bogdanov IV, Shenkarev ZO, Finkina EI, et al. A novel lipid transfer protein from the pea Pisum sativum: isolation, recombinant expression, solution structure, antifungal activity, lipid binding, and allergenic properties. BMC Plant Biol. 2016;16:107. Published 2016 Apr 30. doi:10.1186/s12870-016-0792-6

PMID: 27137920

5.2 Protein Sequence Databases

UniProt: A0A161AT60

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: A0A161AT60

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	KJ569141	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR036312, IPR016140, IPR000528

PANTHER: PTHR33076

PROSITE: PS00597

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download