AMPDB_42 | Histone H2A
PEPTIDE SUMMARY
Histone H2A
1 General Description
AMPDB ID: AMPDB_42
Protein Names: Histone H2A [Cleaved into: Acipensin 1 (Ac1); Acipensin 2 (Ac2); Acipensin 3 (Ac3); Acipensin 4 (Ac4); Acipensin 5 (Ac5); Acipensin 6 (Ac6)]
Protein Family: Histone H2A family
Gene Name: Nil
Protein Length: 76 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLILELAGNAARDNKKTRIIPRHLQL
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 10, 'R': 11, 'N': 3, 'D': 1, 'C': 0, 'Q': 3, 'E': 1, 'G': 10, 'H': 2, 'I': 3, 'L': 8, 'K': 7, 'M': 1, 'F': 1, 'P': 3, 'S': 3, 'T': 3, 'W': 0, 'Y': 2, 'V': 4
Frequencies of Amino Acids
'A': 13.16%, 'R': 14.47%, 'N': 3.95%, 'D': 1.32%, 'C': 0%, 'Q': 3.95%, 'E': 1.32%, 'G': 13.16%, 'H': 2.63%, 'I': 3.95%, 'L': 10.53%, 'K': 9.21%, 'M': 1.32%, 'F': 1.32%, 'P': 3.95%, 'S': 3.95%, 'T': 3.95%, 'W': 0%, 'Y': 2.63%, 'V': 5.26%
Missing Amino Acid(s)
C, W
Most Occurring Amino Acid(s)
R
Less Occurring Amino Acid(s)
D, E, F, M
Hydrophobic Amino Acid(s) Count
40
Hydrophilic Amino Acid(s) Count
36
Basic Amino Acid(s) Count
2
Acidic Amino Acid(s) Count
20
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 8261.7 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 84.868 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 45.03 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.575 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.833 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 12.598 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 16.178 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.237, 0.25, 0.263 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.039 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 2980, 2980 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
C.albicans, E.coli (Gram-negative), L.monocytogenes (Gram-positive), S.aureus (Gram-positive)
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Cytotoxin, Hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Shamova OV, Orlov DS, Balandin SV, et al. Acipensins - Novel Antimicrobial Peptides from Leukocytes of the Russian Sturgeon Acipenser gueldenstaedtii. Acta Naturae. 2014;6(4):99-109. Published 2014 Oct. doi:
PMID: 25558400
5.2 Protein Sequence Databases
UniProt: C0HJQ3
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: C0HJQ3
5.4 Nucleotide Sequence Databases
No entries found in GenBank or EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
PANTHER: PTHR23430
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India