AMPDB_419 | Strongylocin 2

PEPTIDE SUMMARY

Strongylocin 2

1 General Description

AMPDB ID: AMPDB_419

Protein Names: Strongylocin 2 (EeStrongylocin 2)

Protein Family: Nil

Gene Name: Nil

Source Organism: Echinus esculentus (Sea urchin)

Protein Length: 89 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MNIRTASFTFIVVMMILSQTMADRFFNEPEEDDHLVESWNPFKKIAHRHCYPKNECITTNGKKTCKDYSCCQIVLFGKKTRSACTVVAQ

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 4, 'N': 5, 'D': 4, 'C': 6, 'Q': 3, 'E': 5, 'G': 2, 'H': 3, 'I': 6, 'L': 3, 'K': 8, 'M': 4, 'F': 6, 'P': 3, 'S': 5, 'T': 8, 'W': 1, 'Y': 2, 'V': 6

Frequencies of Amino Acids

'A': 5.62%, 'R': 4.49%, 'N': 5.62%, 'D': 4.49%, 'C': 6.74%, 'Q': 3.37%, 'E': 5.62%, 'G': 2.25%, 'H': 3.37%, 'I': 6.74%, 'L': 3.37%, 'K': 8.99%, 'M': 4.49%, 'F': 6.74%, 'P': 3.37%, 'S': 5.62%, 'T': 8.99%, 'W': 1.12%, 'Y': 2.25%, 'V': 6.74%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

K, T

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	10298 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	64.607	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	49.187	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.281	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.6	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.382	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	2.905	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.27, 0.169, 0.191 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.101	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	8480, 8855	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Solstad RG, Li C, Isaksson J, et al. Novel Antimicrobial Peptides EeCentrocins 1, 2 and EeStrongylocin 2 from the Edible Sea Urchin Echinus esculentus Have 6-Br-Trp Post-Translational Modifications. PLoS One. 2016;11(3):e0151820. Published 2016. doi:10.1371/journal.pone.0151820

PMID: 27007817

5.2 Protein Sequence Databases

UniProt: A0A144LVM3

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A0A144LVM3

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	KR494264	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download