AMPDB_4179 | Enterocin E-760

PEPTIDE SUMMARY

Enterocin E-760

1 General Description

AMPDB ID: AMPDB_4179

Protein Names: Enterocin E-760 (Bacteriocin E-760)

Protein Family: Bacteriocin class IIB family

Gene Name: Nil

Source Organism: Enterococcus sp

Protein Length: 62 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

NRWYCNSAAGGVGGAAVCGLAGYVGEAKENIAGEVRKGWGMAGGFTHNKACKSFPGSGWASG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 10, 'R': 2, 'N': 4, 'D': 0, 'C': 3, 'Q': 0, 'E': 3, 'G': 15, 'H': 1, 'I': 1, 'L': 1, 'K': 4, 'M': 1, 'F': 2, 'P': 1, 'S': 4, 'T': 1, 'W': 3, 'Y': 2, 'V': 4

Frequencies of Amino Acids

'A': 16.13%, 'R': 3.23%, 'N': 6.45%, 'D': 0%, 'C': 4.84%, 'Q': 0%, 'E': 4.84%, 'G': 24.19%, 'H': 1.61%, 'I': 1.61%, 'L': 1.61%, 'K': 6.45%, 'M': 1.61%, 'F': 3.23%, 'P': 1.61%, 'S': 6.45%, 'T': 1.61%, 'W': 4.84%, 'Y': 3.23%, 'V': 6.45%

Missing Amino Acid(s)

D, Q

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, I, L, M, P, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6179.89 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	47.419	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	42.563	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.177	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.544	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.91	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	2.905	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.21, 0.387, 0.242 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.113	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	19480, 19605	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

C.freundii (Gram-negative), C.jejuni (Gram-negative), Campylobacter (Gram-negative), E.coli (Gram-negative), K.pneumoniae (Gram-negative), M.morganii (Gram-negative), P.aeruginosa (Gram-negative), P.mirabilis (Gram-negative), S.aureus (Gram-positive), S.choleraesuis, S.enteritidis, S.epidermidis (Gram-positive), S.gallinarum (Gram-positive), S.typhimurium, Y.enterocolitica (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Line JE, Svetoch EA, Eruslanov BV, et al. Isolation and purification of enterocin E-760 with broad antimicrobial activity against gram-positive and gram-negative bacteria. Antimicrob Agents Chemother. 2008;52(3):1094-100. Published 2008 Mar. doi:10.1128/AAC.01569-06

PMID: 18086839

5.2 Protein Sequence Databases

UniProt: P85147

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P85147

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download