AMPDB_4170 | Bacteriocin divergicin M35

PEPTIDE SUMMARY

Bacteriocin divergicin M35

1 General Description

AMPDB ID: AMPDB_4170

Protein Names: Bacteriocin divergicin M35

Protein Family: Bacteriocin class IIA YGNGV family

Gene Name: Nil

Source Organism: Carnobacterium divergens (Lactobacillus divergens)

Protein Length: 43 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

TKYYGNGVYCNSKKCWVDWGTAQGCIDVVIGQLGGGIPGKGKC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 1, 'R': 0, 'N': 2, 'D': 2, 'C': 4, 'Q': 2, 'E': 0, 'G': 10, 'H': 0, 'I': 3, 'L': 1, 'K': 5, 'M': 0, 'F': 0, 'P': 1, 'S': 1, 'T': 2, 'W': 2, 'Y': 3, 'V': 4

Frequencies of Amino Acids

'A': 2.33%, 'R': 0%, 'N': 4.65%, 'D': 4.65%, 'C': 9.3%, 'Q': 4.65%, 'E': 0%, 'G': 23.26%, 'H': 0%, 'I': 6.98%, 'L': 2.33%, 'K': 11.63%, 'M': 0%, 'F': 0%, 'P': 2.33%, 'S': 2.33%, 'T': 4.65%, 'W': 4.65%, 'Y': 6.98%, 'V': 9.3%

Missing Amino Acid(s)

E, F, H, M, R

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

A, L, P, S

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	4525.21 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	65.581	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	-3.737	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.188	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.308	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.647	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	2.747	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.302, 0.326, 0.047 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.116	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	15470, 15720	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.breve (Gram-positive), C.divergens (Gram-positive), L.acidophilus (Gram-positive), L.casei (Gram-positive), L.grayi (Gram-positive), L.ivanovii (Gram-positive), L.lactis (Gram-positive), L.monocytogenes (Gram-positive), L.plantarum (Gram-positive), L.rhamnosus (Gram-positive), L.salivarius (Gram-positive), L.seeligeri (Gram-positive), L.welshimeri (Gram-positive), P.acidilactici (Gram-positive), P.freudenreichii (Gram-positive), P.pentosaceus (Gram-positive), S.thermophilus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Tahiri I, Desbiens M, Benech R, et al. Purification, characterization and amino acid sequencing of divergicin M35: a novel class IIa bacteriocin produced by Carnobacterium divergens M35. Int J Food Microbiol. 2004;97(2):123-36. Published 2004 Dec 15. doi:10.1016/j.ijfoodmicro.2004.04.013

PMID: 15541799

5.2 Protein Sequence Databases

UniProt: P84962

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P84962

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR002633, IPR023384, IPR023388

PANTHER: Not found

PROSITE: PS60030

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download