AMPDB_416 | L-amino acid oxidase Bs29

PEPTIDE SUMMARY

L-amino acid oxidase Bs29

1 General Description

AMPDB ID: AMPDB_416

Protein Names: L-amino acid oxidase Bs29 (BsLAAO) (LAO) (EC 1.4.3.2)

Protein Family: Flavin monoamine oxidase family; FIG1 subfamily

Gene Name: Nil

Source Organism: Bothriechis schlegelii (Eyelash palm pitviper)

Protein Length: 498 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

SCADDRNPLEECFQETDYEEFLEIARNGLKATSNPKHVVIVGAGMSGLSAAYVLAGAGHQVTVLEASERAGGRVRTYRNDKEGWYANLGPMRLPEKHRIVREYITKFGLQLNEFSQENENAWYFIKNIRKRVGEVKKDPGLLQYPVKPSEEGKSAGQLYEESLGKVVEELKRTNCSYILDKYDTYSTKEYLIKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDNIFGYEKRFNEIVDGMDKLPTSMYQAIEEKVRFNARVIKIQQNDNEVTVTYQTSENEMSPVTADYVIVCTTSRAARRITFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDDGIHGGKSTTDLPSRFVYYPNHDFSSGSAVIMAYGIGDDANFFQALDHKDCGDTVINDLSLIHQLTKEEIQSFCYLSKIQRWSLDKYAMGGITTFTPYQFQHFSEALTAPFKRIYFAGEYTAQFHGWIDSTIKSGLTAARDVNRASENPSGIHLSNDN

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 33, 'R': 25, 'N': 25, 'D': 29, 'C': 7, 'Q': 17, 'E': 39, 'G': 36, 'H': 13, 'I': 30, 'L': 35, 'K': 33, 'M': 8, 'F': 23, 'P': 19, 'S': 36, 'T': 30, 'W': 5, 'Y': 27, 'V': 28

Frequencies of Amino Acids

'A': 6.63%, 'R': 5.02%, 'N': 5.02%, 'D': 5.82%, 'C': 1.41%, 'Q': 3.41%, 'E': 7.83%, 'G': 7.23%, 'H': 2.61%, 'I': 6.02%, 'L': 7.03%, 'K': 6.63%, 'M': 1.61%, 'F': 4.62%, 'P': 3.82%, 'S': 7.23%, 'T': 6.02%, 'W': 1%, 'Y': 5.42%, 'V': 5.62%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

217

Hydrophilic Amino Acid(s) Count

281

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	56376.3 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	73.835	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	41.542	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.522	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.737	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	6.078	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-9.205	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.297, 0.233, 0.231 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.11	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	67730, 68105	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-Positive

4.3 Enzymatic Activity

Oxidoreductase

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Vargas MuÃ±oz LJ, Estrada-Gomez S, NÃºÃ±ez V, et al. Characterization and cDNA sequence of Bothriechis schlegeliil-amino acid oxidase with antibacterial activity. Int J Biol Macromol. 2014;69:200-7. Published 2014 Aug. doi:10.1016/j.ijbiomac.2014.05.039

PMID: 24875315

Citation 2: Lomonte B, Escolano J, FernÃ¡ndez J, et al. Snake venomics and antivenomics of the arboreal neotropical pitvipers Bothriechis lateralis and Bothriechis schlegelii. J Proteome Res. 2008;7(6):2445-57. Published 2008 Jun. doi:10.1021/pr8000139

PMID: 18444672

5.2 Protein Sequence Databases

UniProt: A0A024BTN9

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A0A024BTN9

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	KJ513472	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR002937, IPR036188

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download