AMPDB_4140 | Potamin-1

PEPTIDE SUMMARY

Potamin-1

1 General Description

AMPDB ID: AMPDB_4140

Protein Names: Potamin-1 (PT-1)

Protein Family: Protease inhibitor I20 (potato type II proteinase inhibitor) family

Gene Name: Nil

Source Organism: Solanum tuberosum (Potato)

Protein Length: 47 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

DICTNCCAGTKGCNTTSANGAFICEGQSDPKKPKACPLNCDPHIAYA

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 6, 'R': 0, 'N': 4, 'D': 3, 'C': 7, 'Q': 1, 'E': 1, 'G': 4, 'H': 1, 'I': 3, 'L': 1, 'K': 4, 'M': 0, 'F': 1, 'P': 4, 'S': 2, 'T': 4, 'W': 0, 'Y': 1, 'V': 0

Frequencies of Amino Acids

'A': 12.77%, 'R': 0%, 'N': 8.51%, 'D': 6.38%, 'C': 14.89%, 'Q': 2.13%, 'E': 2.13%, 'G': 8.51%, 'H': 2.13%, 'I': 6.38%, 'L': 2.13%, 'K': 8.51%, 'M': 0%, 'F': 2.13%, 'P': 8.51%, 'S': 4.26%, 'T': 8.51%, 'W': 0%, 'Y': 2.13%, 'V': 0%

Missing Amino Acid(s)

M, R, V, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

E, F, H, L, Q, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	4833.47 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	45.957	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	41.553	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.332	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.377	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.004	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-0.344	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.128, 0.298, 0.17 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.043	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	1490, 1865	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

C.albicans

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-candida

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Protease inhibitor, Serine protease inhibitor

4.5 Other Biological Activity

Hemolytic, Enzyme inhibitor, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Kim JY, Park SC, Kim MH, et al. Antimicrobial activity studies on a trypsin-chymotrypsin protease inhibitor obtained from potato. Biochem Biophys Res Commun. 2005;330(3):921-7. Published 2005 May 13. doi:10.1016/j.bbrc.2005.03.057

PMID: 15809084

5.2 Protein Sequence Databases

UniProt: P84813

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P84813

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR003465

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download