AMPDB_4117 | Palustrin-3a
PEPTIDE SUMMARY
Palustrin-3a
1 General Description
AMPDB ID: AMPDB_4117
Protein Names: Palustrin-3a
Protein Family: Frog skin active peptide (FSAP) family; Brevinin subfamily
Gene Name: Nil
Protein Length: 48 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
GIFPKIIGKGIKTGIVNGIKSLVKGVGMKVFKAGLNNIGNTGCNEDEC
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 1, 'R': 0, 'N': 5, 'D': 1, 'C': 2, 'Q': 0, 'E': 2, 'G': 10, 'H': 0, 'I': 7, 'L': 2, 'K': 7, 'M': 1, 'F': 2, 'P': 1, 'S': 1, 'T': 2, 'W': 0, 'Y': 0, 'V': 4
Frequencies of Amino Acids
'A': 2.08%, 'R': 0%, 'N': 10.42%, 'D': 2.08%, 'C': 4.17%, 'Q': 0%, 'E': 4.17%, 'G': 20.83%, 'H': 0%, 'I': 14.58%, 'L': 4.17%, 'K': 14.58%, 'M': 2.08%, 'F': 4.17%, 'P': 2.08%, 'S': 2.08%, 'T': 4.17%, 'W': 0%, 'Y': 0%, 'V': 8.33%
Missing Amino Acid(s)
H, Q, R, W, Y
Most Occurring Amino Acid(s)
G
Less Occurring Amino Acid(s)
A, D, M, P, S
Hydrophobic Amino Acid(s) Count
28
Hydrophilic Amino Acid(s) Count
20
Basic Amino Acid(s) Count
3
Acidic Amino Acid(s) Count
7
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 4933.86 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 99.375 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) -0.806 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.148 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.69 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 10.064 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 3.876 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.313, 0.354, 0.125 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.042 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 0, 125 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Gram Negative Bacteria
4.2 Antimicrobial Activity
Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-gram-negative
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Basir YJ, Knoop FC, Dulka J, et al. Multiple antimicrobial peptides and peptides related to bradykinin and neuromedin N isolated from skin secretions of the pickerel frog, Rana palustris. Biochim Biophys Acta. 2000;1543(1):95-105. Published 2000 Nov 30. doi:10.1016/s0167-4838(00)00191-6
PMID: 11087945
5.2 Protein Sequence Databases
UniProt: P84281
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: P84281
5.4 Nucleotide Sequence Databases
No entries found in GenBank or EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: Not found
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India