AMPDB_41 | L-amino acid oxidase bordonein-L

PEPTIDE SUMMARY

L-amino acid oxidase bordonein-L

1 General Description

AMPDB ID: AMPDB_41

Protein Names: L-amino acid oxidase bordonein-L (LAAO) (LAO) (EC 1.4.3.2)

Protein Family: Flavin monoamine oxidase family; FIG1 subfamily

Gene Name: Nil

Source Organism: Crotalus durissus terrificus (South American rattlesnake)

Protein Length: 516 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MNVFFMFSLLFLAALGSCAHDRNPLEECFRETDYEEFLEIARNGLTVTSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERVGGRVRTYRKKDWYANLGPMRLPTKHRIVREYIRKFGLQLNEFFQENENAWYFIKNIRKRVREVKNNPGILEYPVKPSEEGKSAAQLYVESLRKVVKELKRTNCKYILDKYDTYSTKEYLLKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFGYEKRFDEIVGGMDQLPTSMYEAIKEKVQVHFNARVIEIQQNDRETKVTYQTSANEMSSVTADYVIVCTTSRAARRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCKRKFWEDDGIRGGKSTTDLPSRFIYYPNHNFTSGVGVIIAYGIGDDANFFQALDFKDCADIVINDLSLIHQLPKEDIQTFCRPSMIQRWSLDKYAMGGITTFTPYQFQHFSEALTAPFKRIYFAGEYTAQFHGWIDSTIKSGLTAARDVNRASENPSGIHLSNDNEF

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 36, 'R': 32, 'N': 25, 'D': 28, 'C': 7, 'Q': 16, 'E': 36, 'G': 34, 'H': 13, 'I': 33, 'L': 38, 'K': 34, 'M': 10, 'F': 30, 'P': 20, 'S': 32, 'T': 29, 'W': 5, 'Y': 26, 'V': 32

Frequencies of Amino Acids

'A': 6.98%, 'R': 6.2%, 'N': 4.84%, 'D': 5.43%, 'C': 1.36%, 'Q': 3.1%, 'E': 6.98%, 'G': 6.59%, 'H': 2.52%, 'I': 6.4%, 'L': 7.36%, 'K': 6.59%, 'M': 1.94%, 'F': 5.81%, 'P': 3.88%, 'S': 6.2%, 'T': 5.62%, 'W': 0.97%, 'Y': 5.04%, 'V': 6.2%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

238

Hydrophilic Amino Acid(s) Count

278

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	58919 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	78.624	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	33.917	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.393	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.942	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.054	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	2.79	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.318, 0.215, 0.233 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.118	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	66240, 66615	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Leishmania amazonensis

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-parasitic

4.3 Enzymatic Activity

Oxidoreductase

4.4 Inhibitory Effect

Platelet aggregation inhibiting toxin

4.5 Other Biological Activity

Cytolysis, Toxin, Cytotoxin, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Wiezel GA, Shibao PYT, Cologna CT, et al. In-Depth Venome of the Brazilian Rattlesnake Crotalus durissus terrificus: An Integrative Approach Combining Its Venom Gland Transcriptome and Venom Proteome. J Proteome Res. 2018;17(11):3941-3958. Published 2018 Nov 2. doi:10.1021/acs.jproteome.8b00610

PMID: 30270628

Citation 2: Bordon KC, Wiezel GA, Cabral H, et al. Bordonein-L, a new L-amino acid oxidase from Crotalus durissus terrificus snake venom: isolation, preliminary characterization and enzyme stability. J Venom Anim Toxins Incl Trop Dis. 2015;21:26. Published 2015. doi:10.1186/s40409-015-0025-8

PMID: 26273287

Citation 3: Wiezel GA, Rustiguel JK, Morgenstern D, et al. Insights into the structure, function and stability of bordonein-L, the first L-amino acid oxidase from Crotalus durissus terrificus snake venom. Biochimie. 2019;163:33-49. Published 2019 Aug. doi:10.1016/j.biochi.2019.05.009

PMID: 31078582

5.2 Protein Sequence Databases

UniProt: C0HJE7

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: C0HJE7

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR002937, IPR036188

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download