AMPDB_4094 | Thaumatin-like protein

1 General Description

AMPDB ID: AMPDB_4094

Protein Names: Thaumatin-like protein (allergen Act c 2)

Protein Family: Thaumatin family

Gene Name: TLP CEY00_Acc28854

Source Organism: Actinidia chinensis var. chinensis (Chinese soft-hair kiwi)

Protein Length: 225 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MSTFKSLSLSALLFIAFLFTCARGATFNIINNCPFTVWAAAVPGGGKRLDRGQNWIINPGAGTKGARVWARTGCNFDGAGRGKCQTGDCNGLLQCQAFGQPPNTLAEYALNQFNNLDFFDISLVDGFNVAMEFSPTSGGCTRGIKCTANINEQCPNELRAPGGCNNPCTVFKTDQYCCNSGNCGPTDYSRFFKTRCPDAYSYPKDDQTSTFTCPGGTNYKVVFCP

FASTA format

Counts of Amino Acids

'A': 18, 'R': 10, 'N': 20, 'D': 11, 'C': 17, 'Q': 9, 'E': 4, 'G': 25, 'H': 0, 'I': 8, 'L': 13, 'K': 9, 'M': 2, 'F': 18, 'P': 14, 'S': 11, 'T': 19, 'W': 3, 'Y': 6, 'V': 8

Frequencies of Amino Acids

'A': 8%, 'R': 4.44%, 'N': 8.89%, 'D': 4.89%, 'C': 7.56%, 'Q': 4%, 'E': 1.78%, 'G': 11.11%, 'H': 0%, 'I': 3.56%, 'L': 5.78%, 'K': 4%, 'M': 0.89%, 'F': 8%, 'P': 6.22%, 'S': 4.89%, 'T': 8.44%, 'W': 1.33%, 'Y': 2.67%, 'V': 3.56%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

109

Hydrophilic Amino Acid(s) Count

116

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	24267.4 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	54.711	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	25.007	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.227	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.699	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.954	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	2.949	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.249, 0.311, 0.164 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.12	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	25440, 26440	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

B.cinerea, C.albicans, C.comatus, P.piricola

4.2 Antimicrobial Activity

Antimicrobial, Fungicide, Plant defense, Anti-HIV, Anti-candida

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Maddumage R, Nieuwenhuizen NJ, Bulley SM, et al. Diversity and relative levels of actinidin, kiwellin, and thaumatin-like allergens in 15 varieties of kiwifruit (Actinidia). J Agric Food Chem. 2013;61(3):728-39. Published 2013 Jan 23. doi:10.1021/jf304289f

PMID: 23289429

Citation 2: Pilkington SM, Crowhurst R, Hilario E, et al. A manually annotated Actinidia chinensis var. chinensis (kiwifruit) genome highlights the challenges associated with draft genomes and gene prediction in plants. BMC Genomics. 2018;19(1):257. Published 2018 Apr 16. doi:10.1186/s12864-018-4656-3

PMID: 29661190

Citation 3: Wang H, Ng TB, Ng TB. Isolation of an antifungal thaumatin-like protein from kiwi fruits. Phytochemistry. 2002;61(1):1-6. Published 2002 Sep. doi:10.1016/s0031-9422(02)00144-9

PMID: 12165295

Citation 4: GavroviÄ-JankuloviÄ M, ÄIrkoviÄ T, VuckoviÄ O, et al. Isolation and biochemical characterization of a thaumatin-like kiwi allergen. J Allergy Clin Immunol. 2002;110(5):805-10. Published 2002 Nov. doi:10.1067/mai.2002.128947

PMID: 12417892

Citation 5: Bublin M, Mari A, Ebner C, et al. IgE sensitization profiles toward green and gold kiwifruits differ among patients allergic to kiwifruit from 3 European countries. J Allergy Clin Immunol. 2004;114(5):1169-75. Published 2004 Nov. doi:10.1016/j.jaci.2004.07.016

PMID: 15536427

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: P83958

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	JX905283	GenBank \|\| EMBL
2.	NKQK01000025	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR037176, IPR001938, IPR017949

PANTHER: PTHR31048

PROSITE: PS00316, PS51367

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download