AMPDB_4093 | Omwaprin-a

PEPTIDE SUMMARY

Omwaprin-a

1 General Description

AMPDB ID: AMPDB_4093

Protein Names: Omwaprin-a (Omwaprin) (Oxywaprin-a)

Protein Family: Snake waprin family

Gene Name: Nil

Source Organism: Oxyuranus microlepidotus (Inland taipan) (Diemenia microlepidota)

Protein Length: 50 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

KDRPKKPGLCPPRPQKPCVKECKNDDSCPGQQKCCNYGCKDECRDPIFVG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 0, 'R': 3, 'N': 2, 'D': 5, 'C': 8, 'Q': 3, 'E': 2, 'G': 4, 'H': 0, 'I': 1, 'L': 1, 'K': 8, 'M': 0, 'F': 1, 'P': 8, 'S': 1, 'T': 0, 'W': 0, 'Y': 1, 'V': 2

Frequencies of Amino Acids

'A': 0%, 'R': 6%, 'N': 4%, 'D': 10%, 'C': 16%, 'Q': 6%, 'E': 4%, 'G': 8%, 'H': 0%, 'I': 2%, 'L': 2%, 'K': 16%, 'M': 0%, 'F': 2%, 'P': 16%, 'S': 2%, 'T': 0%, 'W': 0%, 'Y': 2%, 'V': 4%

Missing Amino Acid(s)

A, H, M, T, W

Most Occurring Amino Acid(s)

C, K, P

Less Occurring Amino Acid(s)

F, I, L, S, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	5610.51 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	27.2	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	51.692	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-1.274	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.522	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.404	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.505	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.12, 0.3, 0.06 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.04	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	1490, 1990	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.megaterium, S.warneri (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Nair DG, Fry BG, Alewood P, et al. Antimicrobial activity of omwaprin, a new member of the waprin family of snake venom proteins. Biochem J. 2007;402(1):93-104. Published 2007 Feb 15. doi:10.1042/BJ20060318

PMID: 17044815

Citation 2: Banigan JR, Mandal K, Sawaya MR, et al. Determination of the X-ray structure of the snake venom protein omwaprin by total chemical synthesis and racemic protein crystallography. Protein Sci. 2010;19(10):1840-9. Published 2010 Oct. doi:10.1002/pro.468

PMID: 20669184

5.2 Protein Sequence Databases

UniProt: P83952

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P83952

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR036645, IPR008197

PANTHER: Not found

PROSITE: PS51390

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download