AMPDB_408 | Alpha-lactalbumin

PEPTIDE SUMMARY

Alpha-lactalbumin

1 General Description

AMPDB ID: AMPDB_408

Protein Names: Alpha-lactalbumin (Lactose synthase B protein)

Protein Family: Glycosyl hydrolase 22 family

Gene Name: LALBA

Source Organism: Bubalus bubalis (Domestic water buffalo)

Protein Length: 142 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKDYGGVSLPEWVCTAFHTSGYDTQAIVQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLCEKL

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 6, 'R': 1, 'N': 8, 'D': 14, 'C': 8, 'Q': 7, 'E': 7, 'G': 6, 'H': 4, 'I': 9, 'L': 17, 'K': 12, 'M': 3, 'F': 6, 'P': 2, 'S': 9, 'T': 7, 'W': 4, 'Y': 4, 'V': 8

Frequencies of Amino Acids

'A': 4.23%, 'R': 0.7%, 'N': 5.63%, 'D': 9.86%, 'C': 5.63%, 'Q': 4.93%, 'E': 4.93%, 'G': 4.23%, 'H': 2.82%, 'I': 6.34%, 'L': 11.97%, 'K': 8.45%, 'M': 2.11%, 'F': 4.23%, 'P': 1.41%, 'S': 6.34%, 'T': 4.93%, 'W': 2.82%, 'Y': 2.82%, 'V': 5.63%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	16274.6 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	91.972	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	27.906	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.173	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.668	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.607	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-8.122	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.338, 0.176, 0.232 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.099	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	27960, 28460	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

No Target Organism Found

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Milk protein, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Dayal S, Bhattacharya TK, Vohra V, et al. Genetic polymorphism of alpha-lactalbumin gene in riverine buffalo. DNA Seq. 2005;16(3):173-9. Published 2005 Jun. doi:10.1080/10425170500088205

PMID: 16147872

5.2 Protein Sequence Databases

UniProt: Q9TSN6

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q9TSN6

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF194373	GenBank \|\| EMBL
2.	DQ785796	GenBank \|\| EMBL
3.	AH014129	GenBank \|\| EMBL
4.	AH014130	GenBank \|\| EMBL
5.	AH014131	GenBank \|\| EMBL
6.	AH014132	GenBank \|\| EMBL
7.	AY726617	GenBank \|\| EMBL
8.	EF408824	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_001277865.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001916, IPR019799, IPR000545, IPR023346

PANTHER: PTHR11407:SF32, PTHR11407

PROSITE: PS00128, PS51348

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: bbub:102410146

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download