AMPDB_4078 | Cupiennin-1c

PEPTIDE SUMMARY

Cupiennin-1c

1 General Description

AMPDB ID: AMPDB_4078

Protein Names: Cupiennin-1c (Cu-1c) (M-ctenitoxin-Cs1c) (M-CNTX-Cs1c)

Protein Family: Cationic peptide 04 (cupiennin) family; 01 subfamily

Gene Name: Nil

Source Organism: Cupiennius salei (American wandering spider)

Protein Length: 35 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

GFGSLFKFLAKKVAKTVAKQAAKQGAKYIANKQTE

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 7, 'R': 0, 'N': 1, 'D': 0, 'C': 0, 'Q': 3, 'E': 1, 'G': 3, 'H': 0, 'I': 1, 'L': 2, 'K': 8, 'M': 0, 'F': 3, 'P': 0, 'S': 1, 'T': 2, 'W': 0, 'Y': 1, 'V': 2

Frequencies of Amino Acids

'A': 20%, 'R': 0%, 'N': 2.86%, 'D': 0%, 'C': 0%, 'Q': 8.57%, 'E': 2.86%, 'G': 8.57%, 'H': 0%, 'I': 2.86%, 'L': 5.71%, 'K': 22.86%, 'M': 0%, 'F': 8.57%, 'P': 0%, 'S': 2.86%, 'T': 5.71%, 'W': 0%, 'Y': 2.86%, 'V': 5.71%

Missing Amino Acid(s)

C, D, H, M, P, R, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

E, I, N, S, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	3771.46 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	70	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	33.134	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.34	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.694	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.046	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	6.997	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.257, 0.143, 0.286 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.114	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	1490, 1490	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative), E.faecalis (Gram-positive), P.aeruginosa (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Toxin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Kuhn-Nentwig L, Muller J, Schaller J, et al. Cupiennin 1, a new family of highly basic antimicrobial peptides in the venom of the spider Cupiennius salei (Ctenidae). J Biol Chem. 2002;277(13):11208-16. Published 2002 Mar 29. doi:10.1074/jbc.M111099200

PMID: 11792701

5.2 Protein Sequence Databases

UniProt: P83621

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P83621

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR035164

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download