AMPDB_4075 | Chymotrypsin-elastase inhibitor ixodidin

PEPTIDE SUMMARY

Chymotrypsin-elastase inhibitor ixodidin

1 General Description

AMPDB ID: AMPDB_4075

Protein Names: Chymotrypsin-elastase inhibitor ixodidin

Protein Family: Serine protease inhibitor-like (TIL domain-containing) family

Gene Name: Nil

Source Organism: Rhipicephalus microplus (Cattle tick) (Boophilus microplus)

Protein Length: 65 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

QRGSRGQRCGPGEVFNQCGSACPRVCGRPPAQACTLQCVSGCFCRRGYIRTQRGGCIPERQCHQR

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 11, 'N': 1, 'D': 0, 'C': 10, 'Q': 8, 'E': 2, 'G': 10, 'H': 1, 'I': 2, 'L': 1, 'K': 0, 'M': 0, 'F': 2, 'P': 5, 'S': 3, 'T': 2, 'W': 0, 'Y': 1, 'V': 3

Frequencies of Amino Acids

'A': 4.62%, 'R': 16.92%, 'N': 1.54%, 'D': 0%, 'C': 15.38%, 'Q': 12.31%, 'E': 3.08%, 'G': 15.38%, 'H': 1.54%, 'I': 3.08%, 'L': 1.54%, 'K': 0%, 'M': 0%, 'F': 3.08%, 'P': 7.69%, 'S': 4.62%, 'T': 3.08%, 'W': 0%, 'Y': 1.54%, 'V': 4.62%

Missing Amino Acid(s)

D, K, M, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, L, N, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7129.18 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	36	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	53.322	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.722	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.582	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.137	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	8.472	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.138, 0.292, 0.092 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.046	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	1490, 2115	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

M.luteus (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Protease inhibitor, Serine protease inhibitor

4.5 Other Biological Activity

Enzyme inhibitor, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: FogaÃ§a AC, Almeida IC, Eberlin MN, et al. Ixodidin, a novel antimicrobial peptide from the hemocytes of the cattle tick Boophilus microplus with inhibitory activity against serine proteinases. Peptides. 2006;27(4):667-74. Published 2006 Apr. doi:10.1016/j.peptides.2005.07.013

PMID: 16191451

5.2 Protein Sequence Databases

UniProt: P83516

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P83516

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR036084, IPR002919

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download