AMPDB_406 | Crotamine
PEPTIDE SUMMARY
Crotamine
1 General Description
AMPDB ID: AMPDB_406
Protein Names: Crotamine (Crt) (Myotoxin)
Protein Family: Crotamine-myotoxin family
Gene Name: CRO2 CRT-P1
Protein Length: 65 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MKILYLLFAFLFLAFLSEPGNAYKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSGK
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 3, 'R': 2, 'N': 1, 'D': 2, 'C': 6, 'Q': 1, 'E': 2, 'G': 6, 'H': 2, 'I': 2, 'L': 7, 'K': 11, 'M': 2, 'F': 6, 'P': 4, 'S': 4, 'T': 0, 'W': 2, 'Y': 2, 'V': 0
Frequencies of Amino Acids
'A': 4.62%, 'R': 3.08%, 'N': 1.54%, 'D': 3.08%, 'C': 9.23%, 'Q': 1.54%, 'E': 3.08%, 'G': 9.23%, 'H': 3.08%, 'I': 3.08%, 'L': 10.77%, 'K': 16.92%, 'M': 3.08%, 'F': 9.23%, 'P': 6.15%, 'S': 6.15%, 'T': 0%, 'W': 3.08%, 'Y': 3.08%, 'V': 0%
Missing Amino Acid(s)
T, V
Most Occurring Amino Acid(s)
K
Less Occurring Amino Acid(s)
N, Q
Hydrophobic Amino Acid(s) Count
32
Hydrophilic Amino Acid(s) Count
33
Basic Amino Acid(s) Count
4
Acidic Amino Acid(s) Count
15
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 7519.05 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 58.615 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 61.891 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.294 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.464 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 9.962 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 8.807 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.292, 0.231, 0.215 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.154 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 13980, 14355 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
B.subtilis (Gram-positive), Candida, E.coli (Gram-negative), Trichosporon spp.
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Toxin, Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Rádis-Baptista G, Oguiura N, Hayashi MA, et al. Nucleotide sequence of crotamine isoform precursors from a single South American rattlesnake (Crotalus durissus terrificus). Toxicon. 1999;37(7):973-84. Published 1999 Jul. doi:10.1016/s0041-0101(98)00226-8
PMID: 10484745
Citation 2: Rádis-Baptista G, Kubo T, Oguiura N, et al. Structure and chromosomal localization of the gene for crotamine, a toxin from the South American rattlesnake, Crotalus durissus terrificus. Toxicon. 2003;42(7):747-52. Published 2003 Dec. doi:10.1016/j.toxicon.2003.10.019
PMID: 14757205
Citation 3: Laure CJ, Laure CJ. [The primary structure of crotamine (author's transl)]. Hoppe Seylers Z Physiol Chem. 1975;356(2):213-5. Published 1975 Feb. doi:
PMID: 1176086
Citation 4: Peigneur S, Orts DJ, Prieto da Silva AR, et al. Crotamine pharmacology revisited: novel insights based on the inhibition of KV channels. Mol Pharmacol. 2012;82(1):90-6. Published 2012 Jul. doi:10.1124/mol.112.078188
PMID: 22498659
Citation 5: Chang CC, Tseng KH, Tseng KH. Effect of crotamine, a toxin of South American rattlesnake venom, on the sodium channel of murine skeletal muscle. Br J Pharmacol. 1978;63(3):551-9. Published 1978 Jul. doi:10.1111/j.1476-5381.1978.tb07811.x
PMID: 667499
Citation 6: Mancin AC, Soares AM, Andrião-Escarso SH, et al. The analgesic activity of crotamine, a neurotoxin from Crotalus durissus terrificus (South American rattlesnake) venom: a biochemical and pharmacological study. Toxicon. 1998;36(12):1927-37. Published 1998 Dec. doi:10.1016/s0041-0101(98)00117-2
PMID: 9839677
Citation 7: Kerkis A, Kerkis I, Rádis-Baptista G, et al. Crotamine is a novel cell-penetrating protein from the venom of rattlesnake Crotalus durissus terrificus. FASEB J. 2004;18(12):1407-9. Published 2004 Sep. doi:10.1096/fj.03-1459fje
PMID: 15231729
Citation 8: Nascimento FD, Hayashi MA, Kerkis A, et al. Crotamine mediates gene delivery into cells through the binding to heparan sulfate proteoglycans. J Biol Chem. 2007;282(29):21349-60. Published 2007 Jul 20. doi:10.1074/jbc.M604876200
PMID: 17491023
Citation 9: Rizzi CT, Carvalho-de-Souza JL, Schiavon E, et al. Crotamine inhibits preferentially fast-twitching muscles but is inactive on sodium channels. Toxicon. 2007;50(4):553-62. Published 2007 Sep 15. doi:10.1016/j.toxicon.2007.04.026
PMID: 17588630
Citation 10: Hayashi MA, Nascimento FD, Kerkis A, et al. Cytotoxic effects of crotamine are mediated through lysosomal membrane permeabilization. Toxicon. 2008;52(3):508-17. Published 2008 Sep 1. doi:10.1016/j.toxicon.2008.06.029
PMID: 18662711
Citation 11: Yount NY, Kupferwasser D, Spisni A, et al. Selective reciprocity in antimicrobial activity versus cytotoxicity of hBD-2 and crotamine. Proc Natl Acad Sci U S A. 2009;106(35):14972-7. Published 2009 Sep 1. doi:10.1073/pnas.0904465106
PMID: 19706485
Citation 12: Pereira A, Kerkis A, Hayashi MA, et al. Crotamine toxicity and efficacy in mouse models of melanoma. Expert Opin Investig Drugs. 2011;20(9):1189-200. Published 2011 Sep. doi:10.1517/13543784.2011.602064
PMID: 21834748
Citation 13: Oguiura N, Boni-Mitake M, Affonso R, et al. In vitro antibacterial and hemolytic activities of crotamine, a small basic myotoxin from rattlesnake Crotalus durissus. J Antibiot (Tokyo). 2011;64(4):327-31. Published 2011 Apr. doi:10.1038/ja.2011.10
PMID: 21386851
Citation 14: Nascimento FD, Sancey L, Pereira A, et al. The natural cell-penetrating peptide crotamine targets tumor tissue in vivo and triggers a lethal calcium-dependent pathway in cultured cells. Mol Pharm. 2012;9(2):211-21. Published 2012 Feb 6. doi:10.1021/mp2000605
PMID: 22142367
Citation 15: Yamane ES, Bizerra FC, Oliveira EB, et al. Unraveling the antifungal activity of a South American rattlesnake toxin crotamine. Biochimie. 2013;95(2):231-40. Published 2013 Feb. doi:10.1016/j.biochi.2012.09.019
PMID: 23022146
Citation 16: Kerkis I, Silva Fde S, Pereira A, et al. Biological versatility of crotamine--a cationic peptide from the venom of a South American rattlesnake. Expert Opin Investig Drugs. 2010;19(12):1515-25. Published 2010 Dec. doi:10.1517/13543784.2010.534457
PMID: 21062230
Citation 17: Nicastro G, Franzoni L, de Chiara C, et al. Solution structure of crotamine, a Na+ channel affecting toxin from Crotalus durissus terrificus venom. Eur J Biochem. 2003;270(9):1969-79. Published 2003 May. doi:10.1046/j.1432-1033.2003.03563.x
PMID: 12709056
Citation 18: Fadel V, Bettendorff P, Herrmann T, et al. Automated NMR structure determination and disulfide bond identification of the myotoxin crotamine from Crotalus durissus terrificus. Toxicon. 2005;46(7):759-67. Published 2005 Dec 1. doi:10.1016/j.toxicon.2005.07.018
PMID: 16185738
5.2 Protein Sequence Databases
UniProt: Q9PWF3
5.3 3D Structure Databases
Sl. no. PDB ID Method Resolution Access Links 3D View
AlphaFoldDB: Q9PWF3
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. AF053075 GenBank || EMBL
2. AF223946 GenBank || EMBL
3. AF223947 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR023355, IPR000881
PANTHER: Not found
PROSITE: PS00459, PS51345
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India