AMPDB_4058 | M-oxotoxin-Ot1a

PEPTIDE SUMMARY

M-oxotoxin-Ot1a

1 General Description

AMPDB ID: AMPDB_4058

Protein Names: M-oxotoxin-Ot1a (M-OXTX-Ot1a) (Oxki1) (Oxyopinin-1)

Protein Family: Cationic peptide 02 (oxyopinin-2) family

Gene Name: Nil

Source Organism: Oxyopes takobius (Lynx spider) (Oxyopes foliiformis)

Protein Length: 48 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

FRGLAKLLKIGLKSFARVLKKVLPKAAKAGKALAKSMADENAIRQQNQ

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 9, 'R': 3, 'N': 2, 'D': 1, 'C': 0, 'Q': 3, 'E': 1, 'G': 3, 'H': 0, 'I': 2, 'L': 7, 'K': 9, 'M': 1, 'F': 2, 'P': 1, 'S': 2, 'T': 0, 'W': 0, 'Y': 0, 'V': 2

Frequencies of Amino Acids

'A': 18.75%, 'R': 6.25%, 'N': 4.17%, 'D': 2.08%, 'C': 0%, 'Q': 6.25%, 'E': 2.08%, 'G': 6.25%, 'H': 0%, 'I': 4.17%, 'L': 14.58%, 'K': 18.75%, 'M': 2.08%, 'F': 4.17%, 'P': 2.08%, 'S': 4.17%, 'T': 0%, 'W': 0%, 'Y': 0%, 'V': 4.17%

Missing Amino Acid(s)

C, H, T, W, Y

Most Occurring Amino Acid(s)

A, K

Less Occurring Amino Acid(s)

D, E, M, P

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	5221.33 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	103.958	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	6.91	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.204	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.896	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.924	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	9.998	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.271, 0.167, 0.375 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.042	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.subtilis (Gram-positive), E.coli (Gram-negative), S.aureus (Gram-positive), S.frugiperda

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Toxin, Hemolytic, Insecticidal, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Corzo G, Villegas E, GÃ³mez-Lagunas F, et al. Oxyopinins, large amphipathic peptides isolated from the venom of the wolf spider Oxyopes kitabensis with cytolytic properties and positive insecticidal cooperativity with spider neurotoxins. J Biol Chem. 2002;277(26):23627-37. Published 2002 Jun 28. doi:10.1074/jbc.M200511200

PMID: 11976325

Citation 2: Belokoneva OS, Satake H, Mal'tseva EL, et al. Pore formation of phospholipid membranes by the action of two hemolytic arachnid peptides of different size. Biochim Biophys Acta. 2004;1664(2):182-8. Published 2004 Aug 30. doi:10.1016/j.bbamem.2004.05.007

PMID: 15328050

5.2 Protein Sequence Databases

UniProt: P83247

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P83247

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download