AMPDB_4051 | Antifungal protein ginkbilobin-1

PEPTIDE SUMMARY

Antifungal protein ginkbilobin-1

1 General Description

AMPDB ID: AMPDB_4051

Protein Names: Antifungal protein ginkbilobin-1 (Ginkbilobin) (GNL)

Protein Family: Nil

Gene Name: GNK1 GNL

Source Organism: Ginkgo biloba (Ginkgo) (Maidenhair tree)

Protein Length: 40 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

ANTAFVSSAHNTQKIPAGAPFNRNLRAMLADLRQNAAFAG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 10, 'R': 3, 'N': 5, 'D': 1, 'C': 0, 'Q': 2, 'E': 0, 'G': 2, 'H': 1, 'I': 1, 'L': 3, 'K': 1, 'M': 1, 'F': 3, 'P': 2, 'S': 2, 'T': 2, 'W': 0, 'Y': 0, 'V': 1

Frequencies of Amino Acids

'A': 25%, 'R': 7.5%, 'N': 12.5%, 'D': 2.5%, 'C': 0%, 'Q': 5%, 'E': 0%, 'G': 5%, 'H': 2.5%, 'I': 2.5%, 'L': 7.5%, 'K': 2.5%, 'M': 2.5%, 'F': 7.5%, 'P': 5%, 'S': 5%, 'T': 5%, 'W': 0%, 'Y': 0%, 'V': 2.5%

Missing Amino Acid(s)

C, E, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, H, I, K, M, V

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	4213.75 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	71.25	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	37.12	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.18	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.609	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	12.223	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.089	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.2, 0.275, 0.35 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.075	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.cinerea, C.comatus, F.oxysporum, P.aeruginosa (Gram-negative), R.solani, S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Plant defense, Anti-HIV, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Lectin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Wang H, Ng TB, Ng TB. Ginkbilobin, a novel antifungal protein from Ginkgo biloba seeds with sequence similarity to embryo-abundant protein. Biochem Biophys Res Commun. 2000;279(2):407-11. Published 2000 Dec 20. doi:10.1006/bbrc.2000.3929

PMID: 11118300

5.2 Protein Sequence Databases

UniProt: P83171

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P83171

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download