AMPDB_4046 | Bacteriocin lactococcin MMFII

PEPTIDE SUMMARY

Bacteriocin lactococcin MMFII

1 General Description

AMPDB ID: AMPDB_4046

Protein Names: Bacteriocin lactococcin MMFII

Protein Family: Bacteriocin class IIA YGNGV family

Gene Name: Nil

Source Organism: Lactococcus lactis subsp. lactis (Streptococcus lactis)

Protein Length: 37 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

TSYGNGVHCNKSKCWIDVSELETYKAGTVSNPKDILW

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 1, 'R': 0, 'N': 3, 'D': 2, 'C': 2, 'Q': 0, 'E': 2, 'G': 3, 'H': 1, 'I': 2, 'L': 2, 'K': 4, 'M': 0, 'F': 0, 'P': 1, 'S': 4, 'T': 3, 'W': 2, 'Y': 2, 'V': 3

Frequencies of Amino Acids

'A': 2.7%, 'R': 0%, 'N': 8.11%, 'D': 5.41%, 'C': 5.41%, 'Q': 0%, 'E': 5.41%, 'G': 8.11%, 'H': 2.7%, 'I': 5.41%, 'L': 5.41%, 'K': 10.81%, 'M': 0%, 'F': 0%, 'P': 2.7%, 'S': 10.81%, 'T': 8.11%, 'W': 5.41%, 'Y': 5.41%, 'V': 8.11%

Missing Amino Acid(s)

F, M, Q, R

Most Occurring Amino Acid(s)

K, S

Less Occurring Amino Acid(s)

A, H, P

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	4144.64 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	68.378	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	27.616	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.535	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.288	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.251	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-0.033	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.297, 0.297, 0.135 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.108	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	13980, 14105	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Lactococcus (Gram-positive), Listeria monocytogenes (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-listeria, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Ferchichi M, FrÃ¨re J, Mabrouk K, et al. Lactococcin MMFII, a novel class IIa bacteriocin produced by Lactococcus lactis MMFII, isolated from a Tunisian dairy product. FEMS Microbiol Lett. 2001;205(1):49-55. Published 2001 Nov 27. doi:10.1111/j.1574-6968.2001.tb10924.x

PMID: 11728715

Citation 2: Ferchichi M, Fathallah M, Mansuelle P, et al. Chemical synthesis, molecular modeling, and antimicrobial activity of a novel bacteriocin, MMFII. Biochem Biophys Res Commun. 2001;289(1):13-8. Published 2001 Nov 23. doi:10.1006/bbrc.2001.5908

PMID: 11708769

5.2 Protein Sequence Databases

UniProt: P83002

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P83002

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR002633, IPR023384, IPR023388

PANTHER: Not found

PROSITE: PS60030

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download