AMPDB_403 | Basic phospholipase A2 homolog myotoxin II

1 General Description

AMPDB ID: AMPDB_403

Protein Names: Basic phospholipase A2 homolog myotoxin II (MjTX-II) (svPLA2 homolog) (Basic phospholipase A2 homolog 2) (M-VI)

Protein Family: Phospholipase A2 family; Group II subfamily; K49 sub-subfamily

Gene Name: Nil

Source Organism: Bothrops moojeni (Lance-headed viper) (Caissaca)

Protein Length: 122 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

SLFELGKMILQETGKNPAKSYGVYGCNCGVGGRGKPKDATDRCCYVHKCCYKKLTGCDPKKDRYSYSWKDKTIVCGENNSCLKELCECDKAVAICLRENLDTYNKKYRYNYLKPFCKKADPC

FASTA format

Counts of Amino Acids

'A': 5, 'R': 5, 'N': 7, 'D': 8, 'C': 14, 'Q': 1, 'E': 6, 'G': 10, 'H': 1, 'I': 3, 'L': 9, 'K': 19, 'M': 1, 'F': 2, 'P': 5, 'S': 5, 'T': 5, 'W': 1, 'Y': 10, 'V': 5

Frequencies of Amino Acids

'A': 4.1%, 'R': 4.1%, 'N': 5.74%, 'D': 6.56%, 'C': 11.48%, 'Q': 0.82%, 'E': 4.92%, 'G': 8.2%, 'H': 0.82%, 'I': 2.46%, 'L': 7.38%, 'K': 15.57%, 'M': 0.82%, 'F': 1.64%, 'P': 4.1%, 'S': 4.1%, 'T': 4.1%, 'W': 0.82%, 'Y': 8.2%, 'V': 4.1%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, M, Q, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	13887.1 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	54.344	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	20.851	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.738	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.566	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.735	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	9.221	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.246, 0.221, 0.172 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.107	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	20400, 21275	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

C.albicans, E.coli (Gram-negative), Leishmania sp., S.mansoni

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-parasitic, Anti-gram-negative

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Toxin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: StÃ¡beli RG, Amui SF, Sant'Ana CD, et al. Bothrops moojeni myotoxin-II, a Lys49-phospholipase A2 homologue: an example of function versatility of snake venom proteins. Comp Biochem Physiol C Toxicol Pharmacol. 2006;142(3-4):371-381. Published 2006 Mar-Apr. doi:10.1016/j.cbpc.2005.11.020

PMID: 16442348

Citation 2: Soares AM, Rodrigues VM, Homsi-Brandeburgo MI, et al. A rapid procedure for the isolation of the Lys-49 myotoxin II from Bothrops moojeni (caissaca) venom: biochemical characterization, crystallization, myotoxic and edematogenic activity. Toxicon. 1998;36(3):503-14. Published 1998 Mar. doi:10.1016/s0041-0101(97)00133-5

PMID: 9637370

Citation 3: Watanabe L, Soares AM, Ward RJ, et al. Structural insights for fatty acid binding in a Lys49-phospholipase A2: crystal structure of myotoxin II from Bothrops moojeni complexed with stearic acid. Biochimie. 2005;87(2):161-7. Published 2005 Feb. doi:10.1016/j.biochi.2004.11.005

PMID: 15760708

Citation 4: Salvador GH, Cavalcante WL, Dos Santos JI, et al. Structural and functional studies with mytoxin II from Bothrops moojeni reveal remarkable similarities and differences compared to other catalytically inactive phospholipases Aâ-like. Toxicon. 2013;72:52-63. Published 2013 Sep. doi:10.1016/j.toxicon.2013.06.013

PMID: 23810946

Citation 5: Salvador GH, Dreyer TR, Cavalcante WL, et al. Structural and functional evidence for membrane docking and disruption sites on phospholipase A2-like proteins revealed by complexation with the inhibitor suramin. Acta Crystallogr D Biol Crystallogr. 2015;71(Pt 10):2066-78. Published 2015 Oct. doi:10.1107/S1399004715014443

PMID: 26457430

Citation 6: Salvador GHM, Dos Santos JI, Borges RJ, et al. Structural evidence for a fatty acid-independent myotoxic mechanism for a phospholipase A(2)-like toxin. Biochim Biophys Acta Proteins Proteom. 2018;1866(3):473-481. Published 2018 Mar. doi:10.1016/j.bbapap.2017.12.008

PMID: 29287778

Citation 7: Salvador GHM, Cardoso FF, Gomes AA, et al. Search for efficient inhibitors of myotoxic activity induced by ophidian phospholipase A(2)-like proteins using functional, structural and bioinformatics approaches. Sci Rep. 2019;9(1):510. Published 2019 Jan 24. doi:10.1038/s41598-018-36839-6

PMID: 30679550

Citation 8: Salvador GHM, Gomes AAS, Bryan-QuirÃ³s W, et al. Structural basis for phospholipase A(2)-like toxin inhibition by the synthetic compound Varespladib (LY315920). Sci Rep. 2019;9(1):17203. Published 2019 Nov 20. doi:10.1038/s41598-019-53755-5

PMID: 31748642

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: Q9I834

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF145759	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

PANTHER: PTHR11716

PROSITE: PS00119, PS00118

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download