AMPDB_401 | Ribonuclease 7

1 General Description

AMPDB ID: AMPDB_401

Protein Names: Ribonuclease 7 (RNase 7) (EC 3.1.27.-) (Skin-derived antimicrobial protein 2) (SAP-2)

Protein Family: Pancreatic ribonuclease family

Gene Name: RNASE7 UNQ2516 PRO6006

Source Organism: Homo sapiens (Human)

Protein Length: 156 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MAPARAGFCPLLLLLLLGLWVAEIPVSAKPKGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGAVSLTMCKLTSGKHPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRVL

FASTA format

Counts of Amino Acids

'A': 12, 'R': 5, 'N': 8, 'D': 4, 'C': 9, 'Q': 10, 'E': 3, 'G': 6, 'H': 8, 'I': 4, 'L': 15, 'K': 18, 'M': 5, 'F': 5, 'P': 12, 'S': 12, 'T': 7, 'W': 2, 'Y': 2, 'V': 9

Frequencies of Amino Acids

'A': 7.69%, 'R': 3.21%, 'N': 5.13%, 'D': 2.56%, 'C': 5.77%, 'Q': 6.41%, 'E': 1.92%, 'G': 3.85%, 'H': 5.13%, 'I': 2.56%, 'L': 9.62%, 'K': 11.54%, 'M': 3.21%, 'F': 3.21%, 'P': 7.69%, 'S': 7.69%, 'T': 4.49%, 'W': 1.28%, 'Y': 1.28%, 'V': 5.77%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	17419.5 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	71.923	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	52.889	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.422	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.694	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.362	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	16.168	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.237, 0.244, 0.224 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.058	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	13980, 14480	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Enterococcus faecium (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-Positive

4.3 Enzymatic Activity

Endonuclease, Hydrolase, Nuclease

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Harder J, Schroder JM, Schroder JM. RNase 7, a novel innate immune defense antimicrobial protein of healthy human skin. J Biol Chem. 2002;277(48):46779-84. Published 2002 Nov 29. doi:10.1074/jbc.M207587200

PMID: 12244054

Citation 2: Zhang J, Dyer KD, Rosenberg HF, et al. Human RNase 7: a new cationic ribonuclease of the RNase A superfamily. Nucleic Acids Res. 2003;31(2):602-7. Published 2003 Jan 15. doi:10.1093/nar/gkg157

PMID: 12527768

Citation 3: Clark HF, Gurney AL, Abaya E, et al. The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003;13(10):2265-70. Published 2003 Oct. doi:10.1101/gr.1293003

PMID: 12975309

Citation 4: Heilig R, Eckenberg R, Petit JL, et al. The DNA sequence and analysis of human chromosome 14. Nature. 2003;421(6923):601-7. Published 2003 Feb 6. doi:10.1038/nature01348

PMID: 12508121

Citation 5: Gerhard DS, Wagner L, Feingold EA, et al. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004;14(10B):2121-7. Published 2004 Oct. doi:10.1101/gr.2596504

PMID: 15489334

Citation 6: Becknell B, Eichler TE, Beceiro S, et al. Ribonucleases 6 and 7 have antimicrobial function in the human and murine urinary tract. Kidney Int. 2015;87(1):151-61. Published 2015 Jan. doi:10.1038/ki.2014.268

PMID: 25075772

Citation 7: Huang YC, Lin YM, Chang TW, et al. The flexible and clustered lysine residues of human ribonuclease 7 are critical for membrane permeability and antimicrobial activity. J Biol Chem. 2007;282(7):4626-4633. Published 2007 Feb 16. doi:10.1074/jbc.M607321200

PMID: 17150966

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: Q9H1E1

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AJ131212	GenBank \|\| EMBL
2.	AJ306608	GenBank \|\| EMBL
3.	AJ306609	GenBank \|\| EMBL
4.	AJ306610	GenBank \|\| EMBL
5.	AY170392	GenBank \|\| EMBL
6.	AY359097	GenBank \|\| EMBL
7.	AL161668	GenBank \|\| EMBL
8.	BC074960	GenBank \|\| EMBL
9.	BC112334	GenBank \|\| EMBL

CCDS: CCDS41914.1

RefSeq: NP_115961.2

5.5 Protein-Protein Interaction Databases

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

PANTHER: PTHR11437

PROSITE: PS00127

5.8 Genome Annotation Databases

Ensembl: ENSGT00940000164606

5.9 Phylogenomic Databases

GeneTree: ENSGT00940000164606

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

Download