AMPDB_40 | Theta defensin subunit D
PEPTIDE SUMMARY
Theta defensin subunit D
1 General Description
AMPDB ID: AMPDB_40
Protein Names: Theta defensin subunit D (BTD-d) (BTD-7 subunit 2)
Protein Family: Alpha-defensin family; Theta subfamily
Gene Name: BTDD
Protein Length: 76 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MRTFALLTAMLLLVALQAQAEARQARADEAAAQQQPGADDQGMAHSFTRPENAALPLSESAKGLRCFCRRGVCQLL
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 16, 'R': 7, 'N': 1, 'D': 3, 'C': 3, 'Q': 8, 'E': 4, 'G': 4, 'H': 1, 'I': 0, 'L': 11, 'K': 1, 'M': 3, 'F': 3, 'P': 3, 'S': 3, 'T': 3, 'W': 0, 'Y': 0, 'V': 2
Frequencies of Amino Acids
'A': 21.05%, 'R': 9.21%, 'N': 1.32%, 'D': 3.95%, 'C': 3.95%, 'Q': 10.53%, 'E': 5.26%, 'G': 5.26%, 'H': 1.32%, 'I': 0%, 'L': 14.47%, 'K': 1.32%, 'M': 3.95%, 'F': 3.95%, 'P': 3.95%, 'S': 3.95%, 'T': 3.95%, 'W': 0%, 'Y': 0%, 'V': 2.63%
Missing Amino Acid(s)
I, W, Y
Most Occurring Amino Acid(s)
A
Less Occurring Amino Acid(s)
H, K, N
Hydrophobic Amino Acid(s) Count
42
Hydrophilic Amino Acid(s) Count
34
Basic Amino Acid(s) Count
7
Acidic Amino Acid(s) Count
9
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 8186.43 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 85.132 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 41.35 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.064 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.738 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 8.061 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 0.911 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.211, 0.145, 0.447 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.039 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 0, 125 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
C.albicans, E.coli (Gram-negative), S.aureus (Gram-positive)
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Defensin, Fungicide, Anti-candida, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Garcia AE, Osapay G, Tran PA, et al. Isolation, synthesis, and antimicrobial activities of naturally occurring theta-defensin isoforms from baboon leukocytes. Infect Immun. 2008;76(12):5883-91. Published 2008 Dec. doi:10.1128/IAI.01100-08
PMID: 18852242
5.2 Protein Sequence Databases
UniProt: B6ULW7
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: B6ULW7
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. FJ030942 GenBank || EMBL
CCDS: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR016327, IPR002366
PANTHER: PTHR11876
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India