AMPDB_3982 | Neutrophil defensin 2

PEPTIDE SUMMARY

Neutrophil defensin 2

1 General Description

AMPDB ID: AMPDB_3982

Protein Names: Neutrophil defensin 2 (RMAD-2)

Protein Family: Alpha-defensin family

Gene Name: Nil

Source Organism: Macaca mulatta (Rhesus macaque)

Protein Length: 30 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

ACYCRIPACLAGERRYGTCFYMGRVWAFCC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 4, 'N': 0, 'D': 0, 'C': 6, 'Q': 0, 'E': 1, 'G': 3, 'H': 0, 'I': 1, 'L': 1, 'K': 0, 'M': 1, 'F': 2, 'P': 1, 'S': 0, 'T': 1, 'W': 1, 'Y': 3, 'V': 1

Frequencies of Amino Acids

'A': 13.33%, 'R': 13.33%, 'N': 0%, 'D': 0%, 'C': 20%, 'Q': 0%, 'E': 3.33%, 'G': 10%, 'H': 0%, 'I': 3.33%, 'L': 3.33%, 'K': 0%, 'M': 3.33%, 'F': 6.67%, 'P': 3.33%, 'S': 0%, 'T': 3.33%, 'W': 3.33%, 'Y': 10%, 'V': 3.33%

Missing Amino Acid(s)

D, H, K, N, Q, S

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

E, I, L, M, P, T, V, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	3471.14 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	49	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	79.75	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.413	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.357	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.375	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	2.625	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.3, 0.133, 0.233 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.2	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	9970, 10345	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative), L.monocytogenes (Gram-positive), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Fungicide, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Tang YQ, Yuan J, Miller CJ, et al. Isolation, characterization, cDNA cloning, and antimicrobial properties of two distinct subfamilies of alpha-defensins from rhesus macaque leukocytes. Infect Immun. 1999;67(11):6139-44. Published 1999 Nov. doi:10.1128/IAI.67.11.6139-6144.1999

PMID: 10531277

5.2 Protein Sequence Databases

UniProt: P82317

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P82317

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR016327, IPR006081, IPR006080

PANTHER: PTHR11876

PROSITE: PS00269

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download