AMPDB_3978 | Lectin L6

PEPTIDE SUMMARY

Lectin L6

1 General Description

AMPDB ID: AMPDB_3978

Protein Names: Lectin L6

Protein Family: Tectonin family

Gene Name: Nil

Source Organism: Tachypleus tridentatus (Japanese horseshoe crab)

Protein Length: 221 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

VQWHQIPGKLMHITATPHFLWGVNSNQQIYLCRQPCYDGQWTQISGSLKQVDADDHEVWGVNRNDDIYKRPVDGSGSWVRVSGKLKHVSASGYGYIWGVNSNDQIYKCPKPCNGAWTQVNGRLKQIDGGQSMVYGVNSANAIYRRPVDGSGSWQQISGSLKHITGSGLSEVFGVNSNDQIYRCTKPCSGQWSLIDGRLKQCDATGNTIVGVNSVDNIYRSG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 7, 'R': 10, 'N': 15, 'D': 14, 'C': 7, 'Q': 17, 'E': 2, 'G': 27, 'H': 6, 'I': 15, 'L': 10, 'K': 11, 'M': 2, 'F': 2, 'P': 8, 'S': 22, 'T': 8, 'W': 9, 'Y': 10, 'V': 19

Frequencies of Amino Acids

'A': 3.17%, 'R': 4.52%, 'N': 6.79%, 'D': 6.33%, 'C': 3.17%, 'Q': 7.69%, 'E': 0.9%, 'G': 12.22%, 'H': 2.71%, 'I': 6.79%, 'L': 4.52%, 'K': 4.98%, 'M': 0.9%, 'F': 0.9%, 'P': 3.62%, 'S': 9.95%, 'T': 3.62%, 'W': 4.07%, 'Y': 4.52%, 'V': 8.6%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

E, F, M

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

122

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	24410.2 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	72.217	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	22.873	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.535	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.643	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.649	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	5.108	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.294, 0.326, 0.095 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.095	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	64400, 64775	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Lectin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Saito T, Kawabata S, Hirata M, et al. A novel type of limulus lectin-L6. Purification, primary structure, and antibacterial activity. J Biol Chem. 1995;270(24):14493-9. Published 1995 Jun 16. doi:10.1074/jbc.270.24.14493

PMID: 7782311

Citation 2: Shigenaga T, Takayenoki Y, Kawasaki S, et al. Separation of large and small granules from horseshoe crab (Tachypleus tridentatus) hemocytes and characterization of their components. J Biochem. 1993;114(3):307-16. Published 1993 Sep. doi:10.1093/oxfordjournals.jbchem.a124173

PMID: 8282718

5.2 Protein Sequence Databases

UniProt: P82151

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P82151

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR006624

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download