AMPDB_3960 | Non-specific lipid-transfer protein AP10

1 General Description

AMPDB ID: AMPDB_3960

Protein Names: Non-specific lipid-transfer protein AP10 (Ha-AP10) (LTP) (NsLTP)

Protein Family: Plant LTP family

Gene Name: Nil

Source Organism: Helianthus annuus (Common sunflower)

Protein Length: 116 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLKVRPDMASSLPGKCGISTSIPINPNVNCNTIP

FASTA format

Counts of Amino Acids

'A': 14, 'R': 5, 'N': 6, 'D': 3, 'C': 8, 'Q': 3, 'E': 0, 'G': 9, 'H': 1, 'I': 7, 'L': 9, 'K': 8, 'M': 6, 'F': 0, 'P': 11, 'S': 7, 'T': 11, 'W': 0, 'Y': 1, 'V': 7

Frequencies of Amino Acids

'A': 12.07%, 'R': 4.31%, 'N': 5.17%, 'D': 2.59%, 'C': 6.9%, 'Q': 2.59%, 'E': 0%, 'G': 7.76%, 'H': 0.86%, 'I': 6.03%, 'L': 7.76%, 'K': 6.9%, 'M': 5.17%, 'F': 0%, 'P': 9.48%, 'S': 6.03%, 'T': 9.48%, 'W': 0%, 'Y': 0.86%, 'V': 6.03%

Missing Amino Acid(s)

E, F, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	11954.2 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	83.362	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	31.469	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.147	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.624	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.919	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	9.591	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.207, 0.284, 0.25 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.009	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	1490, 1990	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

F.solani (Gram-positive)

4.2 Antimicrobial Activity

Antimicrobial, Fungicide, Plant defense, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Regente M, de la Canal L, de la Canal L. A cDNA encoding a putative lipid transfer protein expressed in sunflower seeds. J Plant Physiol. 2003;160(2):201-3. Published 2003 Feb. doi:10.1078/0176-1617-00799

PMID: 12685036

Citation 2: Arondel V, Vergnolle C, Tchang F, et al. Bifunctional lipid-transfer: fatty acid-binding proteins in plants. Mol Cell Biochem. 1990;98(1-2):49-56. Published 1990 Oct 15-Nov 8. doi:10.1007/BF00231367

PMID: 2266969

Citation 3: Gonorazky AG, Regente MC, de la Canal L, et al. Stress induction and antimicrobial properties of a lipid transfer protein in germinating sunflower seeds. J Plant Physiol. 2005;162(6):618-24. Published 2005 Jun. doi:10.1016/j.jplph.2004.10.006

PMID: 16008084

Citation 4: Regente MC, Giudici AM, VillalaÃn J, et al. The cytotoxic properties of a plant lipid transfer protein involve membrane permeabilization of target cells. Lett Appl Microbiol. 2005;40(3):183-9. Published 2005. doi:10.1111/j.1472-765X.2004.01647.x

PMID: 15715642

Citation 5: Pagnussat LA, Lombardo C, Regente M, et al. Unexpected localization of a lipid transfer protein in germinating sunflower seeds. J Plant Physiol. 2009;166(8):797-806. Published 2009 May 15. doi:10.1016/j.jplph.2008.11.005

PMID: 19117640

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: P82007

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF529201	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR036312, IPR016140, IPR000528

PANTHER: PTHR33076

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download