AMPDB_3959 | Pleurocidin

1 General Description

AMPDB ID: AMPDB_3959

Protein Names: Pleurocidin

Protein Family: Pleurocidin family

Gene Name: ple1

Source Organism: Pseudopleuronectes americanus (Winter flounder) (Pleuronectes americanus)

Protein Length: 68 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MKFTATFLMMAIFVLMVEPGECGWGSFFKKAAHVGKHVGKAALTHYLGDKQELNKRAVDEDPNVIVFE

FASTA format

Counts of Amino Acids

'A': 7, 'R': 1, 'N': 2, 'D': 3, 'C': 1, 'Q': 1, 'E': 5, 'G': 6, 'H': 3, 'I': 2, 'L': 5, 'K': 7, 'M': 4, 'F': 6, 'P': 2, 'S': 1, 'T': 3, 'W': 1, 'Y': 1, 'V': 7

Frequencies of Amino Acids

'A': 10.29%, 'R': 1.47%, 'N': 2.94%, 'D': 4.41%, 'C': 1.47%, 'Q': 1.47%, 'E': 7.35%, 'G': 8.82%, 'H': 4.41%, 'I': 2.94%, 'L': 7.35%, 'K': 10.29%, 'M': 5.88%, 'F': 8.82%, 'P': 2.94%, 'S': 1.47%, 'T': 4.41%, 'W': 1.47%, 'Y': 1.47%, 'V': 10.29%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

A, K, V

Less Occurring Amino Acid(s)

C, Q, R, S, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7600.92 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	80.294	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	32.259	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.093	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.593	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.614	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.216	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.324, 0.162, 0.309 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.118	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 6990	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

E.coli (Gram-negative), L.mucor (Gram-negative), s.marcescens (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Cole AM, Darouiche RO, Legarda D, et al. Characterization of a fish antimicrobial peptide: gene expression, subcellular localization, and spectrum of activity. Antimicrob Agents Chemother. 2000;44(8):2039-45. Published 2000 Aug. doi:10.1128/AAC.44.8.2039-2045.2000

PMID: 10898673

Citation 2: Douglas SE, Gallant JW, Gong Z, et al. Cloning and developmental expression of a family of pleurocidin-like antimicrobial peptides from winter flounder, Pleuronectes americanus (Walbaum). Dev Comp Immunol. 2001;25(2):137-47. Published 2001 Mar. doi:10.1016/s0145-305x(00)00052-5

PMID: 11113283

Citation 3: Cole AM, Weis P, Diamond G, et al. Isolation and characterization of pleurocidin, an antimicrobial peptide in the skin secretions of winter flounder. J Biol Chem. 1997;272(18):12008-13. Published 1997 May 2. doi:10.1074/jbc.272.18.12008

PMID: 9115266

Citation 4: Syvitski RT, Burton I, Mattatall NR, et al. Structural characterization of the antimicrobial peptide pleurocidin from winter flounder. Biochemistry. 2005;44(19):7282-93. Published 2005 May 17. doi:10.1021/bi0504005

PMID: 15882067

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P81941

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF210241	GenBank \|\| EMBL
2.	AF210242	GenBank \|\| EMBL
3.	AF184223	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR012515

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download