AMPDB_3952 | Corticostatin-related peptide RK-1

PEPTIDE SUMMARY

Corticostatin-related peptide RK-1

1 General Description

AMPDB ID: AMPDB_3952

Protein Names: Corticostatin-related peptide RK-1

Protein Family: Alpha-defensin family

Gene Name: Nil

Source Organism: Oryctolagus cuniculus (Rabbit)

Protein Length: 32 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MPCSCKKYCDPWEVIDGSCGLFNSKYICCREK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 0, 'R': 1, 'N': 1, 'D': 2, 'C': 6, 'Q': 0, 'E': 2, 'G': 2, 'H': 0, 'I': 2, 'L': 1, 'K': 4, 'M': 1, 'F': 1, 'P': 2, 'S': 3, 'T': 0, 'W': 1, 'Y': 2, 'V': 1

Frequencies of Amino Acids

'A': 0%, 'R': 3.13%, 'N': 3.13%, 'D': 6.25%, 'C': 18.75%, 'Q': 0%, 'E': 6.25%, 'G': 6.25%, 'H': 0%, 'I': 6.25%, 'L': 3.13%, 'K': 12.5%, 'M': 3.13%, 'F': 3.13%, 'P': 6.25%, 'S': 9.38%, 'T': 0%, 'W': 3.13%, 'Y': 6.25%, 'V': 3.13%

Missing Amino Acid(s)

A, H, Q, T

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

F, L, M, N, R, V, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	3707.36 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	45.625	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	46.556	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.338	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.444	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.73	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.628	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.25, 0.25, 0.125 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.125	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	8480, 8855	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Bateman A, MacLeod RJ, Lembessis P, et al. The isolation and characterization of a novel corticostatin/defensin-like peptide from the kidney. J Biol Chem. 1996;271(18):10654-9. Published 1996 May 3. doi:10.1074/jbc.271.18.10654

PMID: 8631871

Citation 2: McManus AM, Dawson NF, Wade JD, et al. Three-dimensional structure of RK-1: a novel alpha-defensin peptide. Biochemistry. 2000;39(51):15757-64. Published 2000 Dec 26. doi:10.1021/bi000457l

PMID: 11123900

5.2 Protein Sequence Databases

UniProt: P81655

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P81655

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: 9986.ENSOCUP00000016855

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR041002

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download