AMPDB_395 | Lysozyme-like protein 6

PEPTIDE SUMMARY

Lysozyme-like protein 6

1 General Description

AMPDB ID: AMPDB_395

Protein Names: Lysozyme-like protein 6 (EC 3.2.1.17)

Protein Family: Glycosyl hydrolase 22 family

Gene Name: Lyzl6 Lyc1

Source Organism: Mus musculus (Mouse)

Protein Length: 148 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MLKALFICVASCLLVVNDGNIIHRCSLAKILYEEDLDGFEGYSLPDWLCLAFVESNFNISKVNENVDGSFDYGIFQINSRYWCNDYQSHSENFCHVDCQELLSPNLISTIHCAKKIVSGPGGMKNWVEWKLHCLGRPLSYWMTGCHLG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 3, 'N': 11, 'D': 8, 'C': 10, 'Q': 3, 'E': 8, 'G': 11, 'H': 6, 'I': 10, 'L': 17, 'K': 7, 'M': 3, 'F': 7, 'P': 4, 'S': 13, 'T': 2, 'W': 5, 'Y': 6, 'V': 9

Frequencies of Amino Acids

'A': 3.38%, 'R': 2.03%, 'N': 7.43%, 'D': 5.41%, 'C': 6.76%, 'Q': 2.03%, 'E': 5.41%, 'G': 7.43%, 'H': 4.05%, 'I': 6.76%, 'L': 11.49%, 'K': 4.73%, 'M': 2.03%, 'F': 4.73%, 'P': 2.7%, 'S': 8.78%, 'T': 1.35%, 'W': 3.38%, 'Y': 4.05%, 'V': 6.08%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	16818.3 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	92.162	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	33.897	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.046	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.556	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	5.482	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-6.066	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.365, 0.264, 0.223 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.122	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	36440, 37065	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Micrococcus luteus (Gram-positive), Staphylococcus (Gram-positive)

4.2 Antimicrobial Activity

Antimicrobial, Bacteriolytic enzyme, Anti-gram-Positive

4.3 Enzymatic Activity

Glycosidase, Hydrolase

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Carninci P, Kasukawa T, Katayama S, et al. The transcriptional landscape of the mammalian genome. Science. 2005;309(5740):1559-63. Published 2005 Sep 2. doi:10.1126/science.1112014

PMID: 16141072

Citation 2: Gerhard DS, Wagner L, Feingold EA, et al. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004;14(10B):2121-7. Published 2004 Oct. doi:10.1101/gr.2596504

PMID: 15489334

Citation 3: Huttlin EL, Jedrychowski MP, Elias JE, et al. A tissue-specific atlas of mouse protein phosphorylation and expression. Cell. 2010;143(7):1174-89. Published 2010 Dec 23. doi:10.1016/j.cell.2010.12.001

PMID: 21183079

Citation 4: Wei J, Li SJ, Shi H, et al. Characterisation of Lyzls in mice and antibacterial properties of human LYZL6. Asian J Androl. 2013;15(6):824-30. Published 2013 Nov. doi:10.1038/aja.2013.93

PMID: 24013621

5.2 Protein Sequence Databases

UniProt: Q9DA11

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q9DA11

5.4 Nucleotide Sequence Databases