AMPDB_3948 | Defensin D2

PEPTIDE SUMMARY

Defensin D2

1 General Description

AMPDB ID: AMPDB_3948

Protein Names: Defensin D2 (Antimicrobial peptide D2) (So-D2)

Protein Family: DEFL family; Group IV subfamily

Gene Name: Nil

Source Organism: Spinacia oleracea (Spinach)

Protein Length: 52 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 1, 'R': 6, 'N': 1, 'D': 3, 'C': 8, 'Q': 0, 'E': 1, 'G': 5, 'H': 0, 'I': 3, 'L': 0, 'K': 6, 'M': 1, 'F': 2, 'P': 3, 'S': 6, 'T': 4, 'W': 0, 'Y': 2, 'V': 0

Frequencies of Amino Acids

'A': 1.92%, 'R': 11.54%, 'N': 1.92%, 'D': 5.77%, 'C': 15.38%, 'Q': 0%, 'E': 1.92%, 'G': 9.62%, 'H': 0%, 'I': 5.77%, 'L': 0%, 'K': 11.54%, 'M': 1.92%, 'F': 3.85%, 'P': 5.77%, 'S': 11.54%, 'T': 7.69%, 'W': 0%, 'Y': 3.85%, 'V': 0%

Missing Amino Acid(s)

H, L, Q, V, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

A, E, M, N

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	5803.73 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	24.423	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	55.685	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.81	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.589	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.243	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	7.502	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.135, 0.288, 0.058 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.077	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 3480	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Fusarium

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Plant defense

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Segura A, Moreno M, Molina A, et al. Novel defensin subfamily from spinach (Spinacia oleracea). FEBS Lett. 1998;435(2-3):159-62. Published 1998 Sep 18. doi:10.1016/s0014-5793(98)01060-6

PMID: 9762899

5.2 Protein Sequence Databases

UniProt: P81571

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P81571

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR008176, IPR003614, IPR036574

PANTHER: Not found

PROSITE: PS00940

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download