AMPDB_3942 | Dermaseptin-B3
PEPTIDE SUMMARY
Dermaseptin-B3
1 General Description
AMPDB ID: AMPDB_3942
Protein Names: Dermaseptin-B3 (DRS-B3) (Dermaseptin BIII)
Protein Family: Frog skin active peptide (FSAP) family; Dermaseptin subfamily
Gene Name: Nil
Protein Length: 74 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MAFLKKSVFLVLFLGLVSLSICEEEKREEENEEKQEDDEQSEEKRALWKNMLKGIGKLAGQAALGAVKTLVGAE
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 7, 'R': 2, 'N': 2, 'D': 2, 'C': 1, 'Q': 3, 'E': 13, 'G': 6, 'H': 0, 'I': 2, 'L': 11, 'K': 9, 'M': 2, 'F': 3, 'P': 0, 'S': 4, 'T': 1, 'W': 1, 'Y': 0, 'V': 5
Frequencies of Amino Acids
'A': 9.46%, 'R': 2.7%, 'N': 2.7%, 'D': 2.7%, 'C': 1.35%, 'Q': 4.05%, 'E': 17.57%, 'G': 8.11%, 'H': 0%, 'I': 2.7%, 'L': 14.86%, 'K': 12.16%, 'M': 2.7%, 'F': 4.05%, 'P': 0%, 'S': 5.41%, 'T': 1.35%, 'W': 1.35%, 'Y': 0%, 'V': 6.76%
Missing Amino Acid(s)
H, P, Y
Most Occurring Amino Acid(s)
E
Less Occurring Amino Acid(s)
C, T, W
Hydrophobic Amino Acid(s) Count
37
Hydrophilic Amino Acid(s) Count
37
Basic Amino Acid(s) Count
15
Acidic Amino Acid(s) Count
11
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 8254.52 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 97.568 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 58.81 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.3 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.704 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 4.531 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) -4.043 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.297, 0.162, 0.446 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.054 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 5500, 5500 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Gram Negative Bacteria and Gram Positive Bacteria
4.2 Antimicrobial Activity
Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Charpentier S, Amiche M, Mester J, et al. Structure, synthesis, and molecular cloning of dermaseptins B, a family of skin peptide antibiotics. J Biol Chem. 1998;273(24):14690-7. Published 1998 Jun 12. doi:10.1074/jbc.273.24.14690
PMID: 9614066
Citation 2: Amiche M, Ladram A, Nicolas P, et al. A consistent nomenclature of antimicrobial peptides isolated from frogs of the subfamily Phyllomedusinae. Peptides. 2008;29(11):2074-82. Published 2008 Nov. doi:10.1016/j.peptides.2008.06.017
PMID: 18644413
5.2 Protein Sequence Databases
UniProt: P81485
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: P81485
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. Y16564 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India