AMPDB_3935 | Cecropin-A1

PEPTIDE SUMMARY

Cecropin-A1

1 General Description

AMPDB ID: AMPDB_3935

Protein Names: Cecropin-A1 (AalCecA) (Cecropin-A)

Protein Family: Cecropin family

Gene Name: CECA1 CECA

Source Organism: Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta)

Protein Length: 59 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MNFTKLFAIVLLAALVLLGQTEAGGLKKLGKKLEGVGKRVFKASEKALPVAVGIKALGK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 8, 'R': 1, 'N': 1, 'D': 0, 'C': 0, 'Q': 1, 'E': 3, 'G': 8, 'H': 0, 'I': 2, 'L': 11, 'K': 10, 'M': 1, 'F': 3, 'P': 1, 'S': 1, 'T': 2, 'W': 0, 'Y': 0, 'V': 6

Frequencies of Amino Acids

'A': 13.56%, 'R': 1.69%, 'N': 1.69%, 'D': 0%, 'C': 0%, 'Q': 1.69%, 'E': 5.08%, 'G': 13.56%, 'H': 0%, 'I': 3.39%, 'L': 18.64%, 'K': 16.95%, 'M': 1.69%, 'F': 5.08%, 'P': 1.69%, 'S': 1.69%, 'T': 3.39%, 'W': 0%, 'Y': 0%, 'V': 10.17%

Missing Amino Acid(s)

C, D, H, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

M, N, P, Q, R, S

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6135.57 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	128.983	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	8.142	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.554	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.719	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.16	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	8	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.373, 0.186, 0.39 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.051	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Sun D, Eccleston ED, Fallon AM, et al. Cloning and expression of three cecropin cDNAs from a mosquito cell line. FEBS Lett. 1999;454(1-2):147-51. Published 1999 Jul 2. doi:10.1016/s0014-5793(99)00799-1

PMID: 10413113

Citation 2: Sun D, Eccleston ED, Fallon AM, et al. Peptide sequence of an antibiotic cecropin from the vector mosquito, Aedes albopictus. Biochem Biophys Res Commun. 1998;249(2):410-5. Published 1998 Aug 19. doi:10.1006/bbrc.1998.9150

PMID: 9712710

5.2 Protein Sequence Databases

UniProt: P81417

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P81417

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF145802	GenBank \|\| EMBL
2.	AF394744	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR000875, IPR020400

PANTHER: PTHR38329

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download