AMPDB_3931 | Penaeidin-3c
PEPTIDE SUMMARY
Penaeidin-3c
1 General Description
AMPDB ID: AMPDB_3931
Protein Names: Penaeidin-3c (P3-c) (Pen-3c)
Protein Family: Penaeidin family
Gene Name: Nil
Protein Length: 81 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MRLVVCLVFLASFALVCQGQVYKGGYTRPIPRPPFVRPVPGGPIGPYNGCPVSCRGISFSQARSCCSRLGRCCHVGKGYSG
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 3, 'R': 8, 'N': 1, 'D': 0, 'C': 8, 'Q': 3, 'E': 0, 'G': 12, 'H': 1, 'I': 3, 'L': 5, 'K': 2, 'M': 1, 'F': 4, 'P': 9, 'S': 7, 'T': 1, 'W': 0, 'Y': 4, 'V': 9
Frequencies of Amino Acids
'A': 3.7%, 'R': 9.88%, 'N': 1.23%, 'D': 0%, 'C': 9.88%, 'Q': 3.7%, 'E': 0%, 'G': 14.81%, 'H': 1.23%, 'I': 3.7%, 'L': 6.17%, 'K': 2.47%, 'M': 1.23%, 'F': 4.94%, 'P': 11.11%, 'S': 8.64%, 'T': 1.23%, 'W': 0%, 'Y': 4.94%, 'V': 11.11%
Missing Amino Acid(s)
D, E, W
Most Occurring Amino Acid(s)
G
Less Occurring Amino Acid(s)
H, M, N, T
Hydrophobic Amino Acid(s) Count
46
Hydrophilic Amino Acid(s) Count
35
Basic Amino Acid(s) Count
0
Acidic Amino Acid(s) Count
11
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 8637.24 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 74.444 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 42.657 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.211 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.616 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 9.773 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 9.589 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.309, 0.358, 0.111 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.099 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 5960, 6460 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
E.coli (Gram-negative), M.luteus (Gram-negative), N.crassa
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Fungicide, Anti-gram-negative
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Destoumieux D, Bulet P, Loew D, et al. Penaeidins, a new family of antimicrobial peptides isolated from the shrimp Penaeus vannamei (Decapoda). J Biol Chem. 1997;272(45):28398-406. Published 1997 Nov 7. doi:10.1074/jbc.272.45.28398
PMID: 9353298
Citation 2: Destoumieux D, Muñoz M, Cosseau C, et al. Penaeidins, antimicrobial peptides with chitin-binding activity, are produced and stored in shrimp granulocytes and released after microbial challenge. J Cell Sci. 2000;113 ( Pt 3):461-9. Published 2000 Feb. doi:10.1242/jcs.113.3.461
PMID: 10639333
Citation 3: Destoumieux D, Munoz M, Bulet P, et al. Penaeidins, a family of antimicrobial peptides from penaeid shrimp (Crustacea, Decapoda). Cell Mol Life Sci. 2000;57(8-9):1260-71. Published 2000 Aug. doi:10.1007/pl00000764
PMID: 11028917
5.2 Protein Sequence Databases
UniProt: P81060
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: P81060
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. Y14928 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR009226
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India