AMPDB_3927 | Antimicrobial peptide 1

PEPTIDE SUMMARY

Antimicrobial peptide 1

1 General Description

AMPDB ID: AMPDB_3927

Protein Names: Antimicrobial peptide 1 (AMP1) (MiAMP1)

Protein Family: Nil

Gene Name: Nil

Source Organism: Macadamia integrifolia (Macadamia nut)

Protein Length: 102 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MASTKLFFSVITVMMLIAMASEMVNGSAFTVWSGPGCNNRAERYSKCGCSAIHQKGGYDFSYTGQTAALYNQAGCSGVAHTRFGSSARACNPFGWKSIFIQC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 12, 'R': 4, 'N': 5, 'D': 1, 'C': 6, 'Q': 4, 'E': 2, 'G': 11, 'H': 2, 'I': 5, 'L': 3, 'K': 4, 'M': 5, 'F': 7, 'P': 2, 'S': 12, 'T': 6, 'W': 2, 'Y': 4, 'V': 5

Frequencies of Amino Acids

'A': 11.76%, 'R': 3.92%, 'N': 4.9%, 'D': 0.98%, 'C': 5.88%, 'Q': 3.92%, 'E': 1.96%, 'G': 10.78%, 'H': 1.96%, 'I': 4.9%, 'L': 2.94%, 'K': 3.92%, 'M': 4.9%, 'F': 6.86%, 'P': 1.96%, 'S': 11.76%, 'T': 5.88%, 'W': 1.96%, 'Y': 3.92%, 'V': 4.9%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

A, S

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	10943.5 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	56.569	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	17.517	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.1	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.534	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.841	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	4.807	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.255, 0.294, 0.216 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.127	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	16960, 17335	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

S.cerevisiae

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Plant defense, Anti-yeast

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Marcus JP, Goulter KC, Green JL, et al. Purification, characterisation and cDNA cloning of an antimicrobial peptide from Macadamia integrifolia. Eur J Biochem. 1997;244(3):743-9. Published 1997 Mar 15. doi:10.1111/j.1432-1033.1997.00743.x

PMID: 9108242

Citation 2: McManus AM, Nielsen KJ, Marcus JP, et al. MiAMP1, a novel protein from Macadamia integrifolia adopts a Greek key beta-barrel fold unique amongst plant antimicrobial proteins. J Mol Biol. 1999;293(3):629-38. Published 1999 Oct 29. doi:10.1006/jmbi.1999.3163

PMID: 10543955

5.2 Protein Sequence Databases

UniProt: P80915

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P80915

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	Y10903	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR015791, IPR015201, IPR011024

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download