AMPDB_3915 | Antimicrobial peptide THP1

PEPTIDE SUMMARY

Antimicrobial peptide THP1

1 General Description

AMPDB ID: AMPDB_3915

Protein Names: Antimicrobial peptide THP1 (Turkey heterophil peptide 1)

Protein Family: Beta-defensin family

Gene Name: Nil

Source Organism: Meleagris gallopavo (Wild turkey)

Protein Length: 65 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MRIVYLLFPFILLLAQGAAGSSLALGKREKCLRRNGFCAFLKCPTLSVISGTCSRFQVCCKTLLG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 5, 'N': 1, 'D': 0, 'C': 6, 'Q': 2, 'E': 1, 'G': 6, 'H': 0, 'I': 3, 'L': 12, 'K': 4, 'M': 1, 'F': 5, 'P': 2, 'S': 5, 'T': 3, 'W': 0, 'Y': 1, 'V': 3

Frequencies of Amino Acids

'A': 7.69%, 'R': 7.69%, 'N': 1.54%, 'D': 0%, 'C': 9.23%, 'Q': 3.08%, 'E': 1.54%, 'G': 9.23%, 'H': 0%, 'I': 4.62%, 'L': 18.46%, 'K': 6.15%, 'M': 1.54%, 'F': 7.69%, 'P': 3.08%, 'S': 7.69%, 'T': 4.62%, 'W': 0%, 'Y': 1.54%, 'V': 4.62%

Missing Amino Acid(s)

D, H, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

E, M, N, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7085.65 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	111.077	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	36.954	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.715	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.514	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.097	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	7.626	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.369, 0.215, 0.292 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.092	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	1490, 1865	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Brockus CW, Jackwood MW, Harmon BG, et al. Characterization of beta-defensin prepropeptide mRNA from chicken and turkey bone marrow. Anim Genet. 1998;29(4):283-9. Published 1998 Aug. doi:10.1046/j.1365-2052.1998.00338.x

PMID: 9745666

Citation 2: Evans EW, Beach GG, Wunderlich J, et al. Isolation of antimicrobial peptides from avian heterophils. J Leukoc Biol. 1994;56(5):661-5. Published 1994 Nov. doi:10.1002/jlb.56.5.661

PMID: 7964174

5.2 Protein Sequence Databases

UniProt: P80391

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P80391

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF033337	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001855

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: ENSGT01030000235503

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: ENSGT01030000235503

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download