AMPDB_3910 | Bacteriocin plantaricin-A

1 General Description

AMPDB ID: AMPDB_3910

Protein Names: Bacteriocin plantaricin-A

Protein Family: Nil

Gene Name: plnA lp_0415

Source Organism: Lactiplantibacillus plantarum (strain ATCC BAA-793 NCIMB 8826 WCFS1) (Lactobacillus plantarum)

Protein Length: 48 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MKIQIKGMKQLSNKEMQKIVGGKSSAYSLQMGATAIKQVKKLFKKWGW

FASTA format

Counts of Amino Acids

'A': 3, 'R': 0, 'N': 1, 'D': 0, 'C': 0, 'Q': 5, 'E': 1, 'G': 5, 'H': 0, 'I': 4, 'L': 3, 'K': 11, 'M': 4, 'F': 1, 'P': 0, 'S': 4, 'T': 1, 'W': 2, 'Y': 1, 'V': 2

Frequencies of Amino Acids

'A': 6.25%, 'R': 0%, 'N': 2.08%, 'D': 0%, 'C': 0%, 'Q': 10.42%, 'E': 2.08%, 'G': 10.42%, 'H': 0%, 'I': 8.33%, 'L': 6.25%, 'K': 22.92%, 'M': 8.33%, 'F': 2.08%, 'P': 0%, 'S': 8.33%, 'T': 2.08%, 'W': 4.17%, 'Y': 2.08%, 'V': 4.17%

Missing Amino Acid(s)

C, D, H, P, R

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

E, F, N, T, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	5457.65 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	75.208	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	13.817	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.475	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.828	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.24	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	9.996	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.271, 0.208, 0.229 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.083	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	12490, 12490	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Lactobacillus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Diep DB, HÃ¥varstein LS, Nissen-Meyer J, et al. The gene encoding plantaricin A, a bacteriocin from Lactobacillus plantarum C11, is located on the same transcription unit as an agr-like regulatory system. Appl Environ Microbiol. 1994;60(1):160-6. Published 1994 Jan. doi:10.1128/aem.60.1.160-166.1994

PMID: 8117074

Citation 2: Diep DB, HÃ¥varstein LS, Nes IF, et al. Characterization of the locus responsible for the bacteriocin production in Lactobacillus plantarum C11. J Bacteriol. 1996;178(15):4472-83. Published 1996 Aug. doi:10.1128/jb.178.15.4472-4483.1996

PMID: 8755874

Citation 3: Kleerebezem M, Boekhorst J, van Kranenburg R, et al. Complete genome sequence of Lactobacillus plantarum WCFS1. Proc Natl Acad Sci U S A. 2003;100(4):1990-5. Published 2003 Feb 18. doi:10.1073/pnas.0337704100

PMID: 12566566

Citation 4: Siezen RJ, Francke C, Renckens B, et al. Complete resequencing and reannotation of the Lactobacillus plantarum WCFS1 genome. J Bacteriol. 2012;194(1):195-6. Published 2012 Jan. doi:10.1128/JB.06275-11

PMID: 22156394

Citation 5: Nissen-Meyer J, Larsen AG, Sletten K, et al. Purification and characterization of plantaricin A, a Lactobacillus plantarum bacteriocin whose activity depends on the action of two peptides. J Gen Microbiol. 1993;139(9):1973-8. Published 1993 Sep. doi:10.1099/00221287-139-9-1973

PMID: 8245827

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P80214

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X75323	GenBank \|\| EMBL
2.	X94434	GenBank \|\| EMBL
3.	AL935263	GenBank \|\| EMBL

5.5 Protein-Protein Interaction Databases

STRING: 220668.lp_0415

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR010133

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: lpl:lp_0415

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download