AMPDB_3907 | Cathelicidin-2

PEPTIDE SUMMARY

Cathelicidin-2

1 General Description

AMPDB ID: AMPDB_3907

Protein Names: Cathelicidin-2 (Bactenecin-5) (Bac5) (OaBac5)

Protein Family: Cathelicidin family

Gene Name: CATHL2 BAC5

Source Organism: Ovis aries (Sheep)

Protein Length: 176 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

METQGASLSLGRWSLWLLLLGLVLPSASAQALSYREAVLRAVGQLNERSSEANLYRLLELDPAPNDEVDPGTRKPVSFTVKETVCPRTTQQPPEECDFKENGLVKQCVGTVTLDPSNDQFDINCNELQSVRFRPPIRRPPIRPPFRPPFRPPVRPPIRPPFRPPFRPPIGPFPGRR

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 8, 'R': 20, 'N': 7, 'D': 7, 'C': 4, 'Q': 8, 'E': 11, 'G': 9, 'H': 0, 'I': 5, 'L': 19, 'K': 4, 'M': 1, 'F': 9, 'P': 29, 'S': 11, 'T': 8, 'W': 2, 'Y': 2, 'V': 12

Frequencies of Amino Acids

'A': 4.55%, 'R': 11.36%, 'N': 3.98%, 'D': 3.98%, 'C': 2.27%, 'Q': 4.55%, 'E': 6.25%, 'G': 5.11%, 'H': 0%, 'I': 2.84%, 'L': 10.8%, 'K': 2.27%, 'M': 0.57%, 'F': 5.11%, 'P': 16.48%, 'S': 6.25%, 'T': 4.55%, 'W': 1.14%, 'Y': 1.14%, 'V': 6.82%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	19841.8 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	77.5	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	67.364	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.53	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.715	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.872	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	5.77	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.278, 0.318, 0.222 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.074	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	13980, 14230	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Huttner KM, Lambeth MR, Burkin HR, et al. Localization and genomic organization of sheep antimicrobial peptide genes. Gene. 1998;206(1):85-91. Published 1998 Jan 5. doi:10.1016/s0378-1119(97)00569-6

PMID: 9461419

5.2 Protein Sequence Databases

UniProt: P79362

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P79362

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	U60599	GenBank \|\| EMBL
2.	U60601	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_001009787.1

5.5 Protein-Protein Interaction Databases

STRING: 9940.ENSOARP00000002071

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001894, IPR018216, IPR046350

PANTHER: PTHR10206

PROSITE: PS00946, PS00947

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: oas:443356

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download