AMPDB_39 | Theta defensin subunit B

PEPTIDE SUMMARY

Theta defensin subunit B

1 General Description

AMPDB ID: AMPDB_39

Protein Names: Theta defensin subunit B (BTD-b) (BTD-1 subunit 2) (BTD-2)

Protein Family: Alpha-defensin family; Theta subfamily

Gene Name: BTDB

Source Organism: Papio anubis (Olive baboon)

Protein Length: 76 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MRTFALLTAMLLLVALQPQAEARQARADEAAAQQQPGADDQGMAHSFTRPENAALPLSESAKGLRCVCRRGVCQLL

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 15, 'R': 7, 'N': 1, 'D': 3, 'C': 3, 'Q': 8, 'E': 4, 'G': 4, 'H': 1, 'I': 0, 'L': 11, 'K': 1, 'M': 3, 'F': 2, 'P': 4, 'S': 3, 'T': 3, 'W': 0, 'Y': 0, 'V': 3

Frequencies of Amino Acids

'A': 19.74%, 'R': 9.21%, 'N': 1.32%, 'D': 3.95%, 'C': 3.95%, 'Q': 10.53%, 'E': 5.26%, 'G': 5.26%, 'H': 1.32%, 'I': 0%, 'L': 14.47%, 'K': 1.32%, 'M': 3.95%, 'F': 2.63%, 'P': 5.26%, 'S': 3.95%, 'T': 3.95%, 'W': 0%, 'Y': 0%, 'V': 3.95%

Missing Amino Acid(s)

I, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, K, N

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8164.42 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	87.632	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	45.426	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.091	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.73	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.061	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.911	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.211, 0.158, 0.434 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.026	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 125	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

C.albicans, E.coli (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Fungicide, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Garcia AE, Osapay G, Tran PA, et al. Isolation, synthesis, and antimicrobial activities of naturally occurring theta-defensin isoforms from baboon leukocytes. Infect Immun. 2008;76(12):5883-91. Published 2008 Dec. doi:10.1128/IAI.01100-08

PMID: 18852242

Citation 2: Conibear AC, Rosengren KJ, Harvey PJ, et al. Structural characterization of the cyclic cystine ladder motif of Î¸-defensins. Biochemistry. 2012;51(48):9718-26. Published 2012 Dec 4. doi:10.1021/bi301363a

PMID: 23148585

5.2 Protein Sequence Databases

UniProt: B6ULW5

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: B6ULW5

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	FJ030940	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_001135412.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR016327, IPR002366

PANTHER: PTHR11876

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: panu:100196941

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download