AMPDB_3897 | Aurein-5.2

PEPTIDE SUMMARY

Aurein-5.2

1 General Description

AMPDB ID: AMPDB_3897

Protein Names: Aurein-5.2 (Aurein-5.3)

Protein Family: Frog skin active peptide (FSAP) family; Aurein subfamily

Gene Name: Nil

Source Organism: Ranoidea aurea (Green and golden bell frog) (Litoria aurea)

Protein Length: 71 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MAFLKKSLFLVLFLGLVSLSICEQEKREEENQEEDEENEAASEEKRGLMSSIGKALGGLIVDVLKPKTPAS

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 2, 'N': 2, 'D': 2, 'C': 1, 'Q': 2, 'E': 12, 'G': 5, 'H': 0, 'I': 3, 'L': 11, 'K': 7, 'M': 2, 'F': 3, 'P': 2, 'S': 7, 'T': 1, 'W': 0, 'Y': 0, 'V': 4

Frequencies of Amino Acids

'A': 7.04%, 'R': 2.82%, 'N': 2.82%, 'D': 2.82%, 'C': 1.41%, 'Q': 2.82%, 'E': 16.9%, 'G': 7.04%, 'H': 0%, 'I': 4.23%, 'L': 15.49%, 'K': 9.86%, 'M': 2.82%, 'F': 4.23%, 'P': 2.82%, 'S': 9.86%, 'T': 1.41%, 'W': 0%, 'Y': 0%, 'V': 5.63%

Missing Amino Acid(s)

H, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7825 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	100.282	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	60.434	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.211	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.565	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.349	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-5.044	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.296, 0.225, 0.423 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.042	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

L.lactis (Gram-positive), S.uberis (Gram-positive)

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Chen T, Scott C, Tang L, et al. The structural organization of aurein precursor cDNAs from the skin secretion of the Australian green and golden bell frog, Litoria aurea. Regul Pept. 2005;128(1):75-83. Published 2005 May 15. doi:10.1016/j.regpep.2004.12.022

PMID: 15721491

Citation 2: Rozek T, Wegener KL, Bowie JH, et al. The antibiotic and anticancer active aurein peptides from the Australian Bell Frogs Litoria aurea and Litoria raniformis the solution structure of aurein 1.2. Eur J Biochem. 2000;267(17):5330-41. Published 2000 Sep. doi:10.1046/j.1432-1327.2000.01536.x

PMID: 10951191

5.2 Protein Sequence Databases

UniProt: P69031

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P69031

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AJ850131	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR004275, IPR032021, IPR016322

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download