AMPDB_389 | Defensin beta 118

1 General Description

AMPDB ID: AMPDB_389

Protein Names: Defensin beta 118 (Beta-defensin 18) (DEFB-18) (Epididymal secretory protein 13.6) (ESP13.6)

Protein Family: Beta-defensin family

Gene Name: DEFB118 C20orf63 DEFB18 ESC42

Source Organism: Homo sapiens (Human)

Protein Length: 123 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MKLLLLALPMLVLLPQVIPAYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDHRRVPATSPTPLSDSTPGIIDDILTVRFTTDYFEVSSKKDMVEESEAGRGTETSLPNVHHSS

FASTA format

Counts of Amino Acids

'A': 6, 'R': 7, 'N': 4, 'D': 8, 'C': 6, 'Q': 2, 'E': 8, 'G': 6, 'H': 4, 'I': 5, 'L': 12, 'K': 9, 'M': 3, 'F': 2, 'P': 9, 'S': 12, 'T': 9, 'W': 1, 'Y': 2, 'V': 8

Frequencies of Amino Acids

'A': 4.88%, 'R': 5.69%, 'N': 3.25%, 'D': 6.5%, 'C': 4.88%, 'Q': 1.63%, 'E': 6.5%, 'G': 4.88%, 'H': 3.25%, 'I': 4.07%, 'L': 9.76%, 'K': 7.32%, 'M': 2.44%, 'F': 1.63%, 'P': 7.32%, 'S': 9.76%, 'T': 7.32%, 'W': 0.81%, 'Y': 1.63%, 'V': 6.5%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

L, S

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	13613.6 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	77.642	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	51.666	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.437	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.644	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.373	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.003	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.244, 0.252, 0.236 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.041	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	8480, 8855	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

B.subtilis (Gram-positive), E.coli (Gram-negative), S.aureus (Gram-positive), S.typhimurium

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Liu Q, Hamil KG, Sivashanmugam P, et al. Primate epididymis-specific proteins: characterization of ESC42, a novel protein containing a trefoil-like motif in monkey and human. Endocrinology. 2001;142(10):4529-39. Published 2001 Oct. doi:10.1210/endo.142.10.8422

PMID: 11564719

Citation 2: Kao CY, Chen Y, Zhao YH, et al. ORFeome-based search of airway epithelial cell-specific novel human [beta]-defensin genes. Am J Respir Cell Mol Biol. 2003;29(1):71-80. Published 2003 Jul. doi:10.1165/rcmb.2002-0205OC

PMID: 12600824

Citation 3: Deloukas P, Matthews LH, Ashurst J, et al. The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001;414(6866):865-71. Published 2001 Dec 20-27. doi:10.1038/414865a

PMID: 11780052

Citation 4: Gerhard DS, Wagner L, Feingold EA, et al. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004;14(10B):2121-7. Published 2004 Oct. doi:10.1101/gr.2596504

PMID: 15489334

Citation 5: Schutte BC, Mitros JP, Bartlett JA, et al. Discovery of five conserved beta -defensin gene clusters using a computational search strategy. Proc Natl Acad Sci U S A. 2002;99(4):2129-33. Published 2002 Feb 19. doi:10.1073/pnas.042692699

PMID: 11854508

Citation 6: Yenugu S, Hamil KG, Radhakrishnan Y, et al. The androgen-regulated epididymal sperm-binding protein, human beta-defensin 118 (DEFB118) (formerly ESC42), is an antimicrobial beta-defensin. Endocrinology. 2004;145(7):3165-73. Published 2004 Jul. doi:10.1210/en.2003-1698

PMID: 15033915

Citation 7: Lin Q, Xie K, Chen D, et al. Expression and Functional Characterization of a Novel Antimicrobial Peptide: Human Beta-Defensin 118. Biomed Res Int. 2020;2020:1395304. Published 2020. doi:10.1155/2020/1395304

PMID: 33224970

Citation 8: Hou J, Liu HY, Diao H, et al. The truncated human beta-defensin 118 can modulate lipopolysaccharide mediated inflammatory response in RAW264.7 macrophages. Peptides. 2021;136:170438. Published 2021 Feb. doi:10.1016/j.peptides.2020.170438

PMID: 33181266

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: Q96PH6

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF347073	GenBank \|\| EMBL
2.	AF529415	GenBank \|\| EMBL
3.	AL031650	GenBank \|\| EMBL
4.	BC117378	GenBank \|\| EMBL
5.	AY122471	GenBank \|\| EMBL

CCDS: CCDS13177.1

RefSeq: NP_473453.1

5.5 Protein-Protein Interaction Databases

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR025933

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: ENSGT00530000064565

KEGG: hsa:117285

5.9 Phylogenomic Databases

GeneTree: ENSGT00530000064565

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

Download