AMPDB_3868 | Potassium channel toxin alpha-KTx 1.13

PEPTIDE SUMMARY

Potassium channel toxin alpha-KTx 1.13

1 General Description

AMPDB ID: AMPDB_3868

Protein Names: Potassium channel toxin alpha-KTx 1.13 (Charybdotoxin c) (ChTx-c)

Protein Family: Short scorpion toxin superfamily; Potassium channel inhibitor family; Alpha-KTx 01 subfamily

Gene Name: Nil

Source Organism: Leiurus hebraeus (Deathstalker scorpion) (Leiurus quinquestriatus hebraeus)

Protein Length: 37 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

QFTNVSCTTSKECWSVCEKLYNTSRGKCMNKKCRCYS

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 0, 'R': 2, 'N': 3, 'D': 0, 'C': 6, 'Q': 1, 'E': 2, 'G': 1, 'H': 0, 'I': 0, 'L': 1, 'K': 5, 'M': 1, 'F': 1, 'P': 0, 'S': 5, 'T': 4, 'W': 1, 'Y': 2, 'V': 2

Frequencies of Amino Acids

'A': 0%, 'R': 5.41%, 'N': 8.11%, 'D': 0%, 'C': 16.22%, 'Q': 2.7%, 'E': 5.41%, 'G': 2.7%, 'H': 0%, 'I': 0%, 'L': 2.7%, 'K': 13.51%, 'M': 2.7%, 'F': 2.7%, 'P': 0%, 'S': 13.51%, 'T': 10.81%, 'W': 2.7%, 'Y': 5.41%, 'V': 5.41%

Missing Amino Acid(s)

A, D, H, I, P

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

F, G, L, M, Q, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	4317.99 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	26.216	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	50.765	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.765	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.509	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.863	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	4.627	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.189, 0.243, 0.108 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.108	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	8480, 8855	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.subtilis (Gram-positive), E.coli (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Toxin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Froy O, Sagiv T, Poreh M, et al. Dynamic diversification from a putative common ancestor of scorpion toxins affecting sodium, potassium, and chloride channels. J Mol Evol. 1999;48(2):187-96. Published 1999 Feb. doi:10.1007/pl00006457

PMID: 9929387

5.2 Protein Sequence Databases

UniProt: P59944

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P59944

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR036574, IPR001947

PANTHER: Not found

PROSITE: PS01138

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download