AMPDB_3864 | Scorpine

PEPTIDE SUMMARY

Scorpine

1 General Description

AMPDB ID: AMPDB_3864

Protein Names: Scorpine (Scorpin) (Panscorpine)

Protein Family: Long chain scorpion toxin family; Class 3 subfamily

Gene Name: Nil

Source Organism: Pandinus imperator (Emperor scorpion)

Protein Length: 94 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MNSKLTALIFLGLIAIAYCGWINEEKIQKKIDERMGNTVLGGMAKAIVHKMAKNEFQCMANMDMLGNCEKHCQTSGEKGYCHGTKCKCGTPLSY

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 7, 'R': 1, 'N': 6, 'D': 2, 'C': 7, 'Q': 3, 'E': 6, 'G': 10, 'H': 3, 'I': 7, 'L': 7, 'K': 11, 'M': 7, 'F': 2, 'P': 1, 'S': 3, 'T': 5, 'W': 1, 'Y': 3, 'V': 2

Frequencies of Amino Acids

'A': 7.45%, 'R': 1.06%, 'N': 6.38%, 'D': 2.13%, 'C': 7.45%, 'Q': 3.19%, 'E': 6.38%, 'G': 10.64%, 'H': 3.19%, 'I': 7.45%, 'L': 7.45%, 'K': 11.7%, 'M': 7.45%, 'F': 2.13%, 'P': 1.06%, 'S': 3.19%, 'T': 5.32%, 'W': 1.06%, 'Y': 3.19%, 'V': 2.13%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

P, R, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	10394.3 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	71.702	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	19.098	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.184	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.544	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.492	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.843	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.234, 0.213, 0.287 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.064	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	9970, 10345	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.subtilis (Gram-positive), K.pneumoniae (Gram-negative), Plasmodium berghei

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-plasmodium, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Toxin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Conde R, Zamudio FZ, RodrÃguez MH, et al. Scorpine, an anti-malaria and anti-bacterial agent purified from scorpion venom. FEBS Lett. 2000;471(2-3):165-8. Published 2000 Apr 14. doi:10.1016/s0014-5793(00)01384-3

PMID: 10767415

5.2 Protein Sequence Databases

UniProt: P56972

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P56972

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AJ292361	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR029237

PANTHER: Not found

PROSITE: PS51862

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download